CAZyme Information: K441DRAFT_556414-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_556414-t45_1-p1
• CAZy Family: AA3
• CAZyme Description: glycosyltransferase family 20 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
900	KV748192|CGC1	102286.98	6.6315

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748192:1410805-1413555(-)

Full Sequence      

MWTTSYSVLLPRFLPYTVDFHDLPTPARRPSPPPRLTTTGRRDSITDLQEKKASLFPAPT
PPRTPSATADHEEFFSQLQPSAATHFPKPHDPRSLVRSDSHVPEWGGGLFFNQPRSRADP
APPDTILEYAKAQERAKAAKNRRTQRSPKGRQSRDHCRDDRPWGSEWTVEPAIQGNGGLA
NAVRAAVDAGTMGDIFWVGLIGFPTDSLDGTTKDEIHEKLESEYDALTVYVSDSDLDGHY
VHYCKTILWPVFHYQIPDHPKSKAYEDHSWVYYVHLNQAFADKIVKSYKRGDIIWIHDYH
LLLVPAMIRKKLPDAQIGFFLHTAFPSSEVFRCLAVRKELLEGMLGANLVAFQTREYAHH
FLQTCSRLLIVEATEDGVQLDYHFVNVMSLPIGIDPKALSVAREEQEVLSWIKVMQERYH
GKRLIVARDKLDHVRGVRQKLLAFELFLNKYPEYRDKVVMIQVATSTTENSELAATVSEI
VTRIDAVHSTLAHQPLVFLRQDIAFSQYLALLSVADVLMITSLREGMNLTCHEFVFCQDG
KASDKKHGPVILSEFTGSAAVFDGNELAVNPWDYQKCAEAIKVALDMDEIEKERRYSKLR
DVVVRRTGEHWCTNLTNNLAKVHDEHYRRDTMSIPRLSIAQLSEKYKRANKRLFILDYEG
TLASYGSVTNIILTSPQRVIDALGDILANEKNIVYVMSGRTPEELELIFSRLPNIGLIAE
NGCFVREFGGTDEWISFADYEKSKMWKESVKGILQYYVERVEGSWVEERHCSLIFHYEKA
DEYEAANRQAGDCANHINDACQNQRVRAIPTKNTVCIEPIDWDKGTAATHIFNNMRKELA
PDFLMVAGNDRDDEVIFRWANDMSTNGTISDVTTVSVGNRNTVAMATLTQGTTGKHIYFR

Enzyme Prediction     

EC	2.4.1.15:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	167	620	6.5e-154	0.9284210526315789

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340820	GT20_TPS	0.0	168	614	19	457	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	0.0	197	620	48	469	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
184712	PRK14501	1.65e-170	177	884	28	706	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
223457	OtsA	9.33e-164	175	623	42	481	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
215555	PLN03063	1.37e-129	161	855	26	716	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7177637.1|GT20	0.0	4	894	2	906
CBX97101.1|GT20	0.0	4	894	2	899
QRC93131.1|GT20	0.0	13	894	9	902
QDS72670.1|GT20	0.0	13	894	9	899
QSZ35222.1|GT20	0.0	13	894	9	914

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JBI_A	4.85e-98	202	622	47	465	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVM_A	9.12e-93	216	622	73	477	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5DXF_A	5.85e-92	238	611	146	515	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
5HUT_A	6.36e-92	176	630	31	478	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HUV_A	8.87e-92	176	630	31	478	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14081|TPSX_SCHPO	2.76e-194	169	859	202	895	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 106 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2E11.16c PE=1 SV=1
sp|Q9UUI7|TPSY_SCHPO	1.60e-184	165	886	161	874	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 100 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC22F8.05 PE=1 SV=1
sp|P38426|TPS3_YEAST	2.54e-159	167	818	314	939	Trehalose synthase complex regulatory subunit TPS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS3 PE=1 SV=3
sp|P38427|TSL1_YEAST	2.90e-158	167	827	346	983	Trehalose synthase complex regulatory subunit TSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TSL1 PE=1 SV=1
sp|Q54K57|TPSA_DICDI	5.76e-117	176	781	43	628	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

There is no transmembrane helices in K441DRAFT_556414-t45_1-p1.