CAZyme Information: K441DRAFT_551565-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_551565-t45_1-p1
• CAZy Family: AA3
• CAZyme Description: glycoside hydrolase family 81 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
807		86117.61	4.6422

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748188:1555430-1558097(+)

Full Sequence      

MKPQSAILDARSVPISISLAVTTSYSSAIVSSVQSASLTIEPSVTGSVNTALPSGHDTGL
PFNTTDISTPVGSLAPATTTLNPGPIRATAATSANVFVTIATDAPPAQIQSRSDHPVAQL
GITNQTGPVETNKFYANFFLGGQSNAAWTHPYSVSWSKGTGNALSWGLAVSHIERSQLAW
ASGDPPEYFVNPTGLQSIILSAAELGSSTTLTTDTLEAFSVNVNLAPSRGADPLISFSLV
QGMGFVTGLYNGATPYVESGIFFRTLTYVGQVNYVTYKYRIVLEDSTNWLLYATPTGSLG
APPFTLQNSTLIEGPADFHGTIQVAKNPANTSGEASYDASAGSYAVTATISGSIDNGSGS
YTLAWTKAGIQNQTLIMFGLSHHVESFDSTTSGGLTDIELETTTKGMAKAVGRDQFTMVE
SNLPSDIGFAPWMPGINGASGSQGNTLPSAAISAINSAGAVELNEDMNAQTNLNSMYYSG
KALAKFAGIIYTVNDLGSNSALAAAGLTKLKDSFNVFVNNTQPYPLVYDAVWKGAVSSGT
YIAGDSGIDFGNTYYNDHHFHYSYFVWAAAVIGYLDPTWLTEGTNRAWVNMLVRDYANPS
TEDPYFPLSRSFDWYHGHSWAKGLFESSDGKDEESSSEDAFSSYAIKMWGKVTGDPNMEA
RGNLQLAVHARSLKNYFLLESTNAVQPAKFSPNKVTGILFENKVDHTTYFGTNMEYIQGI
HMIPLNPSSAYTRTPNFVKEEWNMHFANGVADSVQGGWKGILYANLAIIDPVTSYNFFAD
EDFSSSFLDGGASRTWYLAYAAGLGGV

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	115	800	8.6e-217	0.9903536977491961

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	0.0	446	798	1	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	0.0	50	806	13	757	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	5.48e-131	115	434	1	321	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBX94313.1|GH81	4.37e-318	1	804	78	880
QRC95614.1|GH81	5.79e-318	22	807	39	827
CAE6998929.1|GH81	5.53e-314	18	807	39	832
APA08036.1|GH81	1.57e-302	1	806	82	888
QDS75982.1|GH81	7.28e-294	10	806	33	831

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	2.03e-83	106	775	17	694	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	2.38e-83	83	775	20	719	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.91e-80	220	775	138	694	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	4.22e-29	477	776	340	632	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	7.37e-20	556	771	439	651	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	2.42e-270	78	803	161	901	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	1.48e-182	115	806	21	704	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	4.46e-169	95	804	46	737	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q12168|ENG2_YEAST	1.09e-154	104	801	86	775	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|P53753|ENG1_YEAST	2.10e-154	92	804	398	1112	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.982802	0.017212

TMHMM  Annotations     

There is no transmembrane helices in K441DRAFT_551565-t45_1-p1.