CAZyme Information: K441DRAFT_542007-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_542007-t45_1-p1
• CAZy Family: AA3
• CAZyme Description: glycosyltransferase family 2 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
511		58868.17	7.8708

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748181:2764122-2765713(+)

Full Sequence      

MAESKDFTITIPEDAHYTQFDSPATPEKKVRRSLLPEDAIEKTSAFITEWTPFLLVASYY
VFSTCLYMYCSDGLIAIFWFIYMTTNFYIAGATVLEAFMSITPCREARKVVTKADEKGWV
FPTPDDKLLILDLLIVAYLPNEKDIIMDRAIYALEQIVYPRDKIRINILYNTPKPIEPLE
TELHQLTQRYPHARVIKVPGSTSKADNLNYFFTLNTGSDLIAIYDCDHYPHPNGPRWAAE
RFMADEEIDIVQGRCIVFNSNDSFLTSMIAVEFDKIYAVSHPGRATMWGFGLFCGSNGYW
RSSLLRDLKMDGSMLTEDIDSALRAVSKGAKTVHDLNVTSYELAPTTFPAFWKQRLRWAQ
GWAQASVKHLKLVFNKPQNQLHDKDSRSFTTRFGLLSLLLIREMSYYLVTQYTCLVLSFV
IVKFPKSGSELFKLVYFQYPVSQWLFIISIVCLLATLWITNQVKSEFISRWMIIVFSIQY
PFYLVLSATIGLYGHARQIVKYTSWNPTARK

Enzyme Prediction     

No EC number prediction in K441DRAFT_542007-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	221	458	7.1e-23	0.9847715736040609

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133045	CESA_like	1.38e-32	137	318	5	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
133043	CESA_CelA_like	3.62e-25	140	364	10	232	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
224136	BcsA	8.08e-25	136	487	59	394	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133049	CESA_like_2	1.84e-24	151	371	20	239	CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of glucan.
133059	CESA_CaSu_A2	7.46e-23	139	361	7	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7201725.1|GT2	2.27e-285	1	510	1	508
CBX90388.1|GT2	3.94e-285	1	510	1	504
CCD48160.1|GT2	3.53e-235	22	510	72	557
ATZ50909.1|GT2	1.01e-234	22	510	72	557
APA08880.1|GT2	2.55e-231	29	510	84	561

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	7.55e-12	114	364	111	377	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	7.95e-12	114	364	123	389	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	7.95e-12	114	364	124	390	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7LBY_A	9.30e-10	122	364	264	503	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P96587|YDAM_BACSU	7.45e-14	141	381	58	299	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
sp|Q84W54|CSLA1_ARATH	7.40e-11	124	376	120	375	Probable glucomannan 4-beta-mannosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=CSLA1 PE=2 SV=1
sp|Q7PC73|CSLA5_ORYSJ	2.34e-10	219	363	226	371	Probable glucomannan 4-beta-mannosyltransferase 5 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLA5 PE=2 SV=1
sp|P58932|BCSA_XANAC	1.45e-09	122	364	144	383	Cellulose synthase catalytic subunit [UDP-forming] OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsA PE=3 SV=1
sp|Q8X5L7|BCSA_ECO57	3.60e-09	122	364	264	503	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999947	0.000057

TMHMM  Annotations     

Start	End
73	95
405	422
435	457
472	494