CAZyme Information: K441DRAFT_532431-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_532431-t45_1-p1
• CAZy Family: AA3
• CAZyme Description: glycosyltransferase family 50 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
423		48032.37	10.0139

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748176:277438-278869(+)

Full Sequence      

MVQFFSSPRFVFSAAAILRAVLLVYGSLQDAFSPMKYTDIDYFVFTDAARFISQSQSPYT
RDTYRYTPLLAWFIYPITWQGKWFSFGKILFAIGDIVAGWLILLILRSSGKMPKDRALKF
ASIWLLNPMVAQISTRGSSEGLLGVVVSALLWAVLSRRIQLAGLLLGFAVHFKIYPFIYA
TSIIWWLDEEHARGAPSIHSKTLHSRAIGFINSARIALVMYSLFTFTTLNSLMYYMYGWP
FLQHSYFHHLTRIDHRHNFSPYNTLLYLNSSPTGNSTVKLESLAFLPQLFLSAVAIPLAL
AKKDLPSTMLAQTFTFVTFNKVCTSQYFLWYIMFLPFYLPSSTLLRKPSTGIAAGILWIL
GQIIWLQQGYRLEFLGTSSFVPGLWASSILFFIVNIWILGIALEDIATVNDPANHIFAAP
KIQ

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	133	400	7.1e-95	0.9847328244274809

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	8.78e-83	9	403	9	415	GPI mannosyltransferase
252941	Mannosyl_trans	6.25e-70	133	403	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.
399599	PIG-U	2.15e-06	47	251	39	243	GPI transamidase subunit PIG-U. Many eukaryotic proteins are anchored to the cell surface via glycosylphosphatidylinositol (GPI), which is posttranslationally attached to the carboxyl-terminus by GPI transamidase. The mammalian GPI transamidase is a complex of at least four subunits, GPI8, GAA1, PIG-S, and PIG-T. PIG-U is thought to represent a fifth subunit in this complex and may be involved in the recognition of either the GPI attachment signal or the lipid portion of GPI.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC91239.1|GT50	1.94e-199	4	421	6	427
QDS69008.1|GT50	3.05e-199	1	411	1	412
CAE7207511.1|GT50	1.41e-191	3	405	5	420
CBX94852.1|GT50	1.04e-189	4	405	6	422
SMR53900.1|GT50	2.67e-176	8	406	10	403

PDB Hits     

K441DRAFT_532431-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WAH2|GPI14_ASPFU	6.46e-178	1	406	1	421	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1
sp|Q2TXB8|GPI14_ASPOR	6.07e-176	1	407	1	411	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q5B7W0|GPI14_EMENI	3.76e-174	1	410	1	432	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1
sp|Q7S4Z3|GPI14_NEUCR	4.62e-161	5	405	23	484	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1
sp|Q4I073|GPI14_GIBZE	2.20e-153	12	405	14	407	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.897463	0.102558

TMHMM  Annotations     

Start	End
10	28
84	106
133	155
162	184
216	238
283	300
315	337
344	366
381	403