CAZyme Information: K441DRAFT_47589-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_47589-t45_1-p1
• CAZy Family: AA2
• CAZyme Description: glycoside hydrolase family 128 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
304	KV748188|CGC1	32888.90	4.9643

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748188:1610938-1611911(+)

Full Sequence      

MRTFLLLQAFSALPSVLCTTSSKRGLVYVPSEKHPTDDNIWVQSGSDLTWYYNYGPEPSN
PFTGSQMQFVPMLWGASDTSTGTPFLDSVKAQISGGANISYALGFNEPDGQSSTGGSAIP
ADLAASTWIREIEPLRKLGVKLGAPAVTGAPSGFTWLQNFFTQCAGKCTPDFIPVHWYGN
FEGLASHIGQVMGTYPNMTVWVTEYALPNADLTTTETFYNQSSEYFDRMENITHYSYFGA
FRSDVSNVGPNATFLTQNGKLTNIGSWYLGGAATSNIPKGAAGKSALFAGWSLLVTAAAF
WLFV

Enzyme Prediction     

No EC number prediction in K441DRAFT_47589-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	42	268	9.2e-66	0.9821428571428571

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371727	Glyco_hydro_cc	9.17e-79	34	268	4	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE6998938.1|GH128	3.49e-125	1	304	1	315
QRC95620.1|GH128	7.34e-123	1	279	1	283
QDS78158.1|GH128	3.61e-120	21	301	22	303
QSZ28555.1|GH128	1.19e-116	5	297	7	310
APA13134.1|GH128	7.59e-115	20	279	29	289

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UB2_A	3.05e-15	21	209	23	203	Crystal structure of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) [Lentinula edodes],6UB2_B Crystal structure of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) [Lentinula edodes],6UB2_C Crystal structure of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) [Lentinula edodes],6UB2_D Crystal structure of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) [Lentinula edodes],6UB3_A Crystal structure of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) with laminaribiose at the surface-binding site [Lentinula edodes],6UB3_B Crystal structure of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) with laminaribiose at the surface-binding site [Lentinula edodes],6UB4_A Crystal structure (C2 form) of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) in complex with laminaritriose [Lentinula edodes],6UB4_B Crystal structure (C2 form) of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) in complex with laminaritriose [Lentinula edodes],6UB5_A Crystal structure (P21 form) of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) in complex with laminaritriose [Lentinula edodes],6UB6_A Crystal structure of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) in complex with laminaritetraose [Lentinula edodes]

Swiss-Prot Hits     

K441DRAFT_47589-t45_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000261	0.999701	CS pos: 18-19. Pr: 0.9801

TMHMM  Annotations     

There is no transmembrane helices in K441DRAFT_47589-t45_1-p1.