CAZyme Information: K441DRAFT_277653-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_277653-t45_1-p1
• CAZy Family: AA11
• CAZyme Description: glycosyltransferase family 32 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389		44012.02	6.4239

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748231:363296-364639(+)

Full Sequence      

MLTFRRALVISAAVLTLLFIFRSSHSSPTQPKALTADSLVHPEPISKTNAEQPARQETTD
PPKAKPKENGAWKGAGSAQINSKKPKTQISLDDVRKRPLRDQLEYQFPYDVDTKFPAYIW
QTWKYTPASGEFEEVFREAEASWTILHPTFVHEVITDTVAVHLMRHLYASVPEVLEAYNA
LPLPVLKADFFRYLILLARGGIYSDIDTAALKSATDWVPTDVPRTSYGLVIGIEADPDRE
DWAQWYSRRIQFCQWTIQAKPGHPALRNIVANITEETLKRKAEGRLTKDTKNIIEFTGPA
LWTDIIFSFFNDPEYFDMSTSKGNITWEQFTNIKAAKKAGDVIVLPITSFSPGVRQMGAG
EDDDPMAFVKHNFEGTWKPEAERHIGEVI

Enzyme Prediction     

EC	2.4.1.257:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	136	220	1.6e-19	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	5.14e-45	99	370	66	339	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.37e-18	134	219	2	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDS69219.1|GT32	2.02e-204	1	387	1	388
QRC95216.1|GT32	3.74e-201	1	389	1	382
CAE6998557.1|GT32	1.98e-192	1	388	1	397
CBY02465.1|GT32	9.95e-190	1	389	1	385
QHY93508.1|GT32	1.32e-181	1	387	1	390

PDB Hits     

K441DRAFT_277653-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	7.94e-91	69	383	59	385	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	1.38e-79	100	378	129	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P31755|OCH1_YEAST	4.38e-73	77	386	59	478	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P47124|HOC1_YEAST	4.04e-72	79	383	90	395	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.865006	0.135009

TMHMM  Annotations     

There is no transmembrane helices in K441DRAFT_277653-t45_1-p1.