CAZyme Information: K441DRAFT_264343-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_264343-t45_1-p1
• CAZy Family: AA11
• CAZyme Description: SGNH hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
407		45558.74	6.0266

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748226:559830-561589(-)

Full Sequence      

MRFFSSTLSLLAAVASATILQNGQVRDMVFLDTTIASVASDRSWRTYGPSASEISYKGRW
DSKHISWWSAPGLKFSFIGDKVAIGFGNYTSPGVLVAYRLDGQDWMFTNVTANSTHQFIS
STTTSFNLTTQAQLPQTLELRVTNWAYGIQIAGVHVSSSSKLIKLPNYSKTIEIIGDSLS
AGQYATYEGISSYAWGLGAGFGNVEFFITAYPGICLVDTNCWGNPRGQTYQWYHASDTSG
RAVEIYNDNPEVWDFRKRPAADIVVINLGTNDNNTHNNVTNEKFLQSYLEFVQGVHQVYP
YAQIILVSLWNGFSPVGNSYAQGGAFIEEIEEVYNYYKHTGFVHYFNTTGIMQHNDIGPQ
YHPTDVGHVKVASHLMQYIKLNFGWELGATGPEVQHDTLYWNDQQNY

Enzyme Prediction     

No EC number prediction in K441DRAFT_264343-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	172	379	4.7e-26	0.9904306220095693

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238869	Endoglucanase_E_like	6.02e-42	172	380	2	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
238141	SGNH_hydrolase	2.13e-14	172	378	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	2.20e-14	174	368	1	174	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
395531	Lipase_GDSL	3.79e-06	172	375	1	224	GDSL-like Lipase/Acylhydrolase.
239947	SGNH_hydrolase_YpmR_like	0.003	261	378	69	204	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. This subfamily contains sequences similar to Bacillus YpmR.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO21504.1|CE0	2.52e-172	11	403	11	417
CDP24093.1|CE0	8.05e-170	11	407	14	436
VBB73265.1|CE0	1.14e-169	11	407	14	436
AEO54717.1|CE0	1.94e-167	11	407	14	433
EAA35351.3|CE0	2.66e-167	15	407	17	432

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XVH_A	1.85e-06	54	385	2	329	Crystal structure of a Corynascus thermopiles (Myceliophthora fergusii) carbohydrate esterase family 2 (CE2) enzyme plus carbohydrate binding domain (CBD) [Chaetomium]

Swiss-Prot Hits     

K441DRAFT_264343-t45_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.025170	0.974801	CS pos: 17-18. Pr: 0.6730

TMHMM  Annotations     

There is no transmembrane helices in K441DRAFT_264343-t45_1-p1.