CAZyme Information: K441DRAFT_242184-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_242184-t45_1-p1
• CAZy Family: AA1
• CAZyme Description: heme peroxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388		40625.91	6.1076

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748222:1093345-1094511(-)

Full Sequence      

MIRPSLWILAWIASVVQYATAVPTWPSSIDELEDIMFLNTGYRSRGFAVAVTPCSFSAQG
NGRIAAAEWIRTAFHDMATGSVFTGIGGLDASLVFETNGGENIGAAFNTTLTTFAPFLSS
RASMADIIAMGVYTAVRSCGGPVVPVRTGRIDATAAGPEGVPLPQNPTGTFINQFARVGF
NTTEMIAVTACGHTLGGVHAADFPQIVAAGTVANDFQHFDSTTIFDEKVASEFVSGTTTN
PLVVGPSVGNGRNSDGRVFAADGNVTIKAMANPSTFASTCRTVLQKLIDVVPSGTALTDS
ITPYEVKPYAVQLTLLDGGATISFTGDIRVRTTVRPASQIANVQLVYKDRSGGTSCGSCI
INTSYKGAAAGFDDSFTVRSFKKTTSVF

Enzyme Prediction     

No EC number prediction in K441DRAFT_242184-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	63	222	1.3e-25	0.6313725490196078

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173829	plant_peroxidase_like_1	4.30e-139	25	289	1	264	Uncharacterized family of plant peroxidase-like proteins. This is a subgroup of heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX) which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions.
173823	plant_peroxidase_like	1.02e-21	66	288	18	254	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
395089	peroxidase	2.57e-20	57	199	7	155	Peroxidase.
173826	ligninase	2.62e-14	66	251	38	221	Ligninase and other manganese-dependent fungal peroxidases. Ligninases and related extracellular fungal peroxidases belong to class II of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class II peroxidases are fungal glycoproteins that have been implicated in the oxidative breakdown of lignin, the main cell wall component of woody plants. They contain four conserved disulphide bridges and two conserved calcium binding sites.
173825	ascorbate_peroxidase	9.23e-14	70	200	34	169	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA18666.1|AA5_1	1.69e-152	1	387	1	392
QBZ57066.1|AA0	1.53e-123	21	376	22	381
VBB76056.1|AA0	8.16e-120	21	376	25	381
QRW22025.1|AA2	4.45e-92	9	352	5	351
QRV94524.1|AA2	7.86e-89	12	352	9	348

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IYN_A	8.35e-06	70	196	29	166	Crystal structure of chloroplastic ascorbate peroxidase from tobacco plants and structural insights for its instability [Nicotiana tabacum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AUF4|WSCD2_ARTBC	3.87e-172	11	382	9	382	WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07870 PE=1 SV=1
sp|Q8GY91|APX6_ARATH	3.37e-11	66	196	114	247	Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana OX=3702 GN=APX6 PE=2 SV=1
sp|Q93V93|PER44_ARATH	1.92e-06	26	230	16	233	Peroxidase 44 OS=Arabidopsis thaliana OX=3702 GN=PER44 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000214	0.999750	CS pos: 21-22. Pr: 0.9790

TMHMM  Annotations     

There is no transmembrane helices in K441DRAFT_242184-t45_1-p1.