CAZyme Information: K441DRAFT_216923-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_216923-t45_1-p1
• CAZy Family: AA1
• CAZyme Description: heme peroxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
516		53911.55	4.6824

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748179:4583157-4584947(-)

Full Sequence      

MRAFLFSSFVLFLSLLPLSLLPSSHSAFHYPTALLSRLEHLLVDTDGAFRSGFKDAITPC
SNYVSGSQLFGRQTSSQWLRVAFHDFVTAHIDEGTGGIDASIGFETLRSEDSGSAFNDSF
AFFAPYVDARTSMADLVALSVVLSVGNCGGPQVPLRGGRIDATTGGAFGVPEPETNLTET
LAEFASAGFNAADSIGLTACGHSLGRVHHGGFPQVVPASAVTANNTAGGINLDSTPAEFD
VVVVREYLGGYGQRGGPLVTSDNVTARSDLRLYESDGNATMRALGASKEGFAATCEGLFE
RMVNTVPKEVVLSAVVTPLRVKPVNVSFDIDLAEDPLGGLVFGGSIRVLRSDDERTASAL
SKTGSNIWGNTTFYPFSVTVPTNNSAPFALIISGSGIPSTTFKLQSAAFLIPSLTSATNN
DLTISAAVLKGYAKGVVAVSAQIASPIPQQGTLAPAITSQSVDLVYSKSVGNYDIYSVAL
ASDAAADLSKTSVDITAEFKGGSKVVDEYNLLTFLS

Enzyme Prediction     

No EC number prediction in K441DRAFT_216923-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	74	212	1.5e-21	0.5568627450980392

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173829	plant_peroxidase_like_1	1.95e-93	38	304	8	264	Uncharacterized family of plant peroxidase-like proteins. This is a subgroup of heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX) which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions.
173823	plant_peroxidase_like	8.38e-20	48	304	2	255	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
395089	peroxidase	1.27e-15	78	208	19	155	Peroxidase.
173826	ligninase	4.36e-13	79	241	42	200	Ligninase and other manganese-dependent fungal peroxidases. Ligninases and related extracellular fungal peroxidases belong to class II of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class II peroxidases are fungal glycoproteins that have been implicated in the oxidative breakdown of lignin, the main cell wall component of woody plants. They contain four conserved disulphide bridges and two conserved calcium binding sites.
173827	secretory_peroxidase	3.28e-09	78	208	36	173	Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW22025.1|AA2	1.73e-65	30	509	21	525
QYT03617.1|AA2	1.20e-64	30	486	26	520
QKD59397.1|AA0	8.01e-64	38	361	29	339
QRV79935.1|AA2	1.80e-62	30	507	22	526
QGI68923.1|AA0	2.26e-62	38	361	29	339

PDB Hits     

K441DRAFT_216923-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AUF4|WSCD2_ARTBC	4.29e-58	33	516	25	509	WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07870 PE=1 SV=1
sp|Q70LM3|PEM2_PHLRA	8.33e-10	59	312	43	303	Manganese peroxidase 2 OS=Phlebia radiata OX=5308 GN=mnp2 PE=1 SV=1
sp|Q8GY91|APX6_ARATH	6.06e-08	79	205	118	247	Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana OX=3702 GN=APX6 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000189	0.999799	CS pos: 26-27. Pr: 0.9692

TMHMM  Annotations     

There is no transmembrane helices in K441DRAFT_216923-t45_1-p1.