CAZyme Information: K441DRAFT_18749-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_18749-t45_1-p1
• CAZy Family: AA1
• CAZyme Description: glycosyltransferase family 69 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
464	KV748185|CGC3	52568.31	5.3471

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748185:2842587-2844038(-)

Full Sequence      

MFRRKVTVLLQAGCLLLAASSLIVGFTYFGNNSSGNATRAASFAHKWPFSSNNAPANATE
SKTSPSPKEDSPATPSTTPGAKEGNTTLFQIAPPYIKAILTPEDDYFPRLKCPRLKCPRP
NLHRYDYLRLNSTNEVSLPKYYFALDLHDCVHVLPRLLGSVVETIRFLGPQNCALSVVEG
RSVDGTFEILKLLREEVEQMGAKYFLTTNEVHPWGQDVNRVEALAELRNQALQPLVDYSS
QYSPETTVVFLNDVALCFEDILELIHQRVYQEADMTCAMDWTYVGADPTFYDVWIARDMN
GDTFFDIPEDGNWDSAWNLFWNNPGARARLNAGRPFQVFACWNGATAFTAKPIFERKIKF
RSSYEGECYSGEPQLFCKDMWHTGYGKIAVVPSINIEYGDEAAQKIKSLKGYTSRWVAAE
RRNGMSLKVKWEQSPPAQTRCIVDYANQYWVPWDEQLEEHESDS

Enzyme Prediction     

No EC number prediction in K441DRAFT_18749-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT69	140	382	2.4e-76	0.99581589958159

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403053	CAP59_mtransfer	8.95e-101	140	376	1	225	Cryptococcal mannosyltransferase 1. The capsule of pathogenic fungi is a complex polysaccharide whose formation is determined by a number of enzymes including, most importantly, alpha-1,3-mannosyltransferase 1, EC:2.4.1.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC99639.1|GT69	1.44e-161	71	457	63	444
CAE7199884.1|GT69	6.02e-159	4	457	5	441
UQC84687.1|GT69	4.64e-143	83	458	108	474
CAP61615.1|GT69	7.61e-143	100	454	1	349
CDP27968.1|GT69	7.61e-143	100	454	1	349

PDB Hits     

K441DRAFT_18749-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6U1Z4|CMT1_CRYNJ	2.28e-45	154	441	142	441	Alpha-1,3-mannosyltransferase CMT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CMT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.830858	0.169155

TMHMM  Annotations     

Start	End
7	29