CAZyme Information: K441DRAFT_108041-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_108041-t45_1-p1
• CAZy Family: AA1
• CAZyme Description: glycosyltransferase family 2 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
782	KV748195|CGC2	88432.65	7.4380

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748195:502900-505407(-)

Full Sequence      

MSTIRRIDDGDYIDIQQQLDNENNRRSSATASQQSTTSTFVSTPSDTLDGFRESKYELKE
EYIESRAESREEIQHTSTRPPMARMSRLRSLGDLYAESPEITPLATPSQPWTLGSGRNSV
NSSFTTPTPLRSEELLKPLFPYAPSSTLFDRDWEKEGSIAHLHRRDDHEQLSAWKRYLYY
LTPFLAIATLGTYWLYFTLRILFVISAQRKSQETFPLAWAFIGVEMATAVPVFLQLFWSV
FILKRRNRPQLRLVGNDVPTVDIFITCCGEDVDLVLDTTRATCEVDYPQDRFRVVILDDA
NCTDLRQAIGHLEEVYPNLVYRCRPKFPGVPHHFKAGNLNYGIQEVLSMPGGASQYVAAL
DADMIPEPHWLRAVIPHLVRDPKMALACPPQLFYNVPPNDPLCQSLDFFVHVSEPIKDAL
GVAWCTGSGYIARRDALEEIGFFPQGSIAEDVATSTLLLGRGWKTAYVHEPLQFGTVPDS
FGSHLKQRTRWALGTVETSFQLKFGLWGKAIEKMTFYQRFSTFIYAVLSLFNIILTISLF
ALPVVLISGKPLIAYSNGTQLRWLIRACFASLFTNRLCEFALFIPSGYQTGQRGSRAQLW
MSPYIALTIIRSFVLPIWLGGQKQAFKPSGSLKSELSERDPAVRAPLLRRLRVIVINYLA
GYHILYVYFCLAAVTLTTSRCAAEQYTINDQLLCGLTHAFWPPIAWIIVVSAFWIPISYA
INPPSMPDREALLNRDPKTGVAHPTEQSKKIAFLGPQMAIWEIEYGLSTLFTAAVFGAAF
FY

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	356	545	6.5e-23	0.9796954314720813

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	2.68e-95	259	498	1	233	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
224136	BcsA	1.87e-42	215	619	11	404	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
236918	bcsA	6.36e-26	259	519	260	508	cellulose synthase catalytic subunit; Provisional
133057	CESA_NdvC_like	2.34e-23	263	497	2	230	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
133045	CESA_like	3.61e-22	263	451	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDS67697.1|GT2	7.52e-309	80	781	87	806
XP_748682.1|GT2|2.4.1.-	5.51e-298	130	782	77	727
EAL86644.1|GT2|2.4.1.-	5.51e-298	130	782	77	727
QGI63586.1|GT2	6.35e-298	115	782	154	830
CCT67598.1|GT2	1.28e-297	115	782	154	830

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	1.48e-22	247	497	115	377	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.68e-22	247	497	127	389	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.68e-22	247	497	128	390	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7LBY_A	5.64e-22	259	512	273	517	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0CW87|ACSA1_KOMXY	5.14e-26	225	527	116	411	Cellulose synthase 1 OS=Komagataeibacter xylinus OX=28448 GN=acsAB PE=1 SV=1
sp|P19449|BCSA1_KOMXY	8.07e-26	225	497	116	379	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsA PE=1 SV=1
sp|O82859|BCSA2_KOMSB	1.07e-25	225	527	116	413	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter sucrofermentans (strain ATCC 700178 / DSM 15973 / CECT 7291 / JCM 9730 / LMG 18788 / BPR 2001) OX=1307942 GN=bcsA PE=3 SV=1
sp|Q9WX61|BCSA3_KOMXY	2.42e-25	225	497	116	379	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1
sp|Q9WX75|BCSA5_KOMXY	1.83e-24	233	552	124	433	Putative cellulose synthase 3 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-B PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

Start	End
177	199
219	241
523	545
599	621
654	676
699	721
759	781