CAZyme Information: I317_07774-t43_1-p1

Basic Information

• Species: Kwoniella heveanensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella heveanensis
• CAZyme ID: I317_07774-t43_1-p1
• CAZy Family: GT90
• CAZyme Description: endoglucanase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
523	KV700321|CGC1	60320.99	6.5889

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KheveanensisCBS569	8002	1296119	131	7871

• Gene Location: location=KV700321:18123-21944(-)

Full Sequence      

MGSFQSKPAANAKARAEPAGLETRTSDEYLRVRGDKITLREEEVILKGAAIGGWMNMENF
ITGYTGHEHQLRAAMKDALGEEKYEFFFDKFLQYFFQEEDAKFFASLGLNCIRIPVNYHH
FEDDMNPRVFKKEGLKHLDRVVDICAKHGIYTVIDLHAAPGGQNFDWHSDNATHKALFYD
HKDFQDRTILIWEHLARHYKNNTWVAGYNPLNEPTDEKHVRLISFYERVEKAIRAIDPNH
ILFLDTFASDFSHFDKPLPNSVYTCHDYSDYGFPNPPEPYTGSKEQVALHQRSFEDKTAY
MRKHKGPIWVGEWGPVYQNTNDGIPDWEKINDTRFEVLKLQLGIFGDAGASWSIWLYKDI
GFQGMVYAAEDTAYVKLLKDFLRKKRSLAADKWGADDTPVRALFTPLEQWLESACPSFKN
RYPAPTAGGVNSSWKIGNHVSRLMRNILLSEELVLEFASVFKGKSYAELDELAKSFEFAQ
CVQRERLNQILKADSKRTDHVDEKVQARSSGQQVWNWSEKTIV

Enzyme Prediction     

EC	3.2.1.4:2	3.2.1.37:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	72	360	3.5e-124	0.9965034965034965

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	7.58e-25	93	314	22	237	Cellulase (glycosyl hydrolase family 5).
225344	BglC	3.16e-18	94	358	72	363	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
225343	BglB	2.37e-06	94	157	58	121	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW44253.2|GH5_22	1.13e-261	29	514	17	494
AFR96086.2|GH5_22	1.60e-261	29	514	17	494
AUB25961.1|GH5_22	1.60e-261	29	514	17	494
ADV22976.1|GH5_22	2.85e-246	29	505	17	468
UOH81960.1|GH5_22	1.85e-225	29	514	10	506

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	4.96e-15	83	273	16	197	Chain A, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	1.19e-14	83	273	16	197	Chain A, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
1EQP_A	2.89e-09	45	214	8	187	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
3O6A_A	5.17e-09	34	214	2	192	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
3N9K_A	5.17e-09	34	214	2	192	F229A/E292S Double Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|W8QRE4|XYL5_PHACH	1.29e-191	29	491	3	465	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
sp|P16169|GUNA_RUMFL	4.83e-17	45	335	7	281	Cellodextrinase A OS=Ruminococcus flavefaciens OX=1265 GN=celA PE=3 SV=3
sp|A3DJ77|GUNC_ACET2	1.06e-14	83	273	16	197	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
sp|P23340|GUNC_CLOSF	1.06e-14	83	273	16	197	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
sp|P0C2S3|GUNC_ACETH	2.55e-14	83	273	16	197	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I317_07774-t43_1-p1.