CAZyme Information: I317_07429-t43_1-p1

Basic Information

• Species: Kwoniella heveanensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella heveanensis
• CAZyme ID: I317_07429-t43_1-p1
• CAZy Family: GT8
• CAZyme Description: galactinol synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
396		44599.58	5.6312

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KheveanensisCBS569	8002	1296119	131	7871

• Gene Location: location=KV700289:46062-47829(-)

Full Sequence      

MALTADIDEPPHDAAASTESGSGLGFGLEPELEDVRKAWITLITNEAYVAGLLTLHRTLV
SLSSYPLIAMTTSSLSSASQDLITSASIPIIQVDHLTPSQGQHGGFDPSFSRFDDAWTKL
QVFGLEQFETLILIDSDMIFLKEMDELFEYELPARDWVGAAPACVCNPLKLAHYPKDWIP
ANCAYRHQTPYTALSEPPIPSTAPDSPRTSHLLNSGLVILHPSKTTLQQIVHHLNTSPTI
AKVQFADQDVMAEVFRARWKPLPWWCNALKTLRAVHQDVWRDEEVRLIHYILDKPWHRRP
AHLAPHISITDLPPTPITASNGPLGRHFGDESDKPIRRPLPAGLLDAVRSTDKSQESLTD
YQDVHAWWWIVYEDLLDDYKAVGDERWKLIDRHVKR

Enzyme Prediction     

No EC number prediction in I317_07429-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	37	298	7.1e-36	0.8793774319066148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	1.25e-57	38	375	2	240	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
227884	Gnt1	2.16e-09	108	231	148	277	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
279798	Glyco_transf_8	5.21e-08	40	298	2	250	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
133064	GT8_GNT1	8.86e-07	38	170	2	140	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
215090	PLN00176	2.01e-06	34	296	20	266	galactinol synthase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW42342.1|GT8	2.26e-165	28	396	7	371
UOH80095.1|GT8	1.74e-162	30	396	9	371
AUB23492.1|GT8	4.96e-162	37	396	15	371
AFR93902.1|GT8	4.96e-162	37	396	15	371
ADV21194.1|GT8	3.30e-160	37	396	15	371

PDB Hits     

I317_07429-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XGN4|GOLS1_AJURE	1.50e-11	36	296	22	266	Galactinol synthase 1 OS=Ajuga reptans OX=38596 GN=GOLS1 PE=1 SV=1
sp|Q5UNW1|YR707_MIMIV	1.89e-10	38	298	5	236	Uncharacterized protein R707 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R707 PE=4 SV=1
sp|Q8H1S1|GOLS6_ARATH	2.14e-10	35	296	23	269	Galactinol synthase 6 OS=Arabidopsis thaliana OX=3702 GN=GOLS6 PE=2 SV=1
sp|Q9FFA1|GOLS5_ARATH	3.85e-09	33	296	18	266	Galactinol synthase 5 OS=Arabidopsis thaliana OX=3702 GN=GOLS5 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000006	0.000030

TMHMM  Annotations     

There is no transmembrane helices in I317_07429-t43_1-p1.