CAZyme Information: I317_07224-t43_1-p1

Basic Information

• Species: Kwoniella heveanensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella heveanensis
• CAZyme ID: I317_07224-t43_1-p1
• CAZy Family: GT76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
857	KV700279|CGC1	97908.92	4.9537

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KheveanensisCBS569	8002	1296119	131	7871

• Gene Location: location=KV700279:3932-7372(+)

Full Sequence      

MAPWNTTSLNRDWSFSQAASKYSSAEIKEEWHPCNIPTSVHVELKKLGKIPDPFKDLNEW
EVQWIQESDWVFKTTFDVEESRLKQDNVDLVFEGLDTYCDISLNGKVLFSVENMFLHHRV
PCKEAIKSKGNQLELHFKSPWHEARLAEEQNGGPMPLWNGASNRLYSRKAQYGWGWDWGP
VMMTVGPWKGIQLETYDARISDVRIDTTLSGDDYDQGSLQANIVVEGKQRNGYKVDIQLK
DAAGKSVKSATDHLVAEPLRWDFGKNEIQGWYPRGYGAQPLYELEITLKSSEGHVFQTTT
RRVAFRSAKVVQEPLADQEGTSFVFEINGIRVFCGGSNWIPADSFLTEIEPGRFRRWVDL
LIKGNQNMLRVWGGGVYEDTELYDACDENGILVWQDFMFGCGLYPSYPHLNDSIKIEAEQ
AVTRLRDHPSVVIFAGNNEDYQVAESLGVMDYSDNSGDYMKSKFPARHIYEVLLPEVVDR
LSTIFYHRSSPYGGKTSSDQTVGDIHQWNVWHGTQEPWTNWDKLAGRFVSEFGMQGYPDI
RTVNEWTDDKSQLFPQSRVSVNHNKADGFERRLELYLMENFRHAFDMESYVYYTQIMQAE
CLASAYRLWRRNFKGRGKEYTSGALVWQINDCWPCVSWAIADYYLRPKPAFFTIARELKA
YTVGITRKDVKKYTDKISSAFFEITQQLELWSCNSTLEVVKAQVVLDSYNLSTGDKRSQA
FDIELAANSSTEIWTGVCPGQSTRTNDAQVPEPIVVQTRLYLSSEPEVVAARYSNWPEPF
KYLTFSDPKLNAKVDGDKVTLTAEKPIKGIILDVKDGEECEWSDQAIDLFPGDEQVIVAK
GLKGREVVARYLGDGSA

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	5	746	3.6e-81	0.7273936170212766

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	9.87e-73	7	654	13	626	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407658	Mannosidase_ig	8.36e-13	686	782	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
395572	Glyco_hydro_2	2.57e-08	198	306	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
407625	Ig_mannosidase	0.009	787	837	1	54	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW19045.1|GH2	0.0	37	857	19	851
QRV91212.1|GH2	0.0	28	857	84	927
QRW05283.1|GH2	0.0	28	857	34	891
QRV76379.1|GH2	0.0	28	857	34	888
CED84166.1|GH2	3.74e-301	3	856	2	869

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	1.26e-145	1	831	21	802	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	1.75e-117	9	838	11	815	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	1.84e-117	9	838	13	817	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	1.88e-117	9	838	13	817	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	4.90e-117	9	838	11	815	Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I2C092|MANBB_THETO	9.63e-240	1	853	1	853	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
sp|Q5B7W2|MANBB_EMENI	1.80e-228	9	851	9	838	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
sp|B8NW36|MANBB_ASPFN	9.49e-226	1	851	1	839	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
sp|Q2TXB7|MANBB_ASPOR	5.36e-225	1	851	1	839	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
sp|A1CGA8|MANBB_ASPCL	1.56e-224	1	851	1	840	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I317_07224-t43_1-p1.