CAZyme Information: I317_07117-t43_1-p1

Basic Information

• Species: Kwoniella heveanensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella heveanensis
• CAZyme ID: I317_07117-t43_1-p1
• CAZy Family: GT69
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
639		71177.31	6.3350

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KheveanensisCBS569	8002	1296119	131	7871

• Gene Location: location=KV700273:34715-37239(-)

Full Sequence      

MGASRDSDDDLELLSYGRAQPAAGSSSSRPLLSNDNEHSHPSSSSPPPISPSRRRHLRNA
SSTGWLHRRHPTLYLVLKRWWKPCTAILIPFVLLFLYALIHPHVKGLPPLPKVHITTGST
SALGDYDDYDFDSPIPGKEVVYQEKIVEGCSCGITDEGKRLCKVYHEEGLRNSRLVQGTG
ARMRRVLQKAREGESLKIGVLGGSVSACHGVHPSADYPQGDPAGPGCYTTLLKKWFQTTF
PDAEHELMNGAIGGMDSSYYAFCGTHHIATDTDLIVLEFDVNDQADLLYQAFFDQLLRAL
SEFQTQPAILILGAWSPQVAQDQGYGDPQIVHAPISLYYDVPYVSMKRLMFNHYLRYPKS
TAESFFQPDMVHPKARGHRILADLLIAYLESELCMLTHYGLPIVPSISNTISTSDPFSSL
VDIPFPLDTLHLVDPITPPEGWESTFEQKPIDALADESRHFVLPSTPYSVPPVGIFTPLR
DVVDPRQADPTSGQHITGLVQPELFCADANDKEHPMKPTSSEGWESFVWNGEKHYWVSST
PGSRIRVEIKVNAGRVAVYYFRSQHYNLGDARCWVDDNEKGAVHLSGYWTKQYNVAVVAY
IDEKVTPGDHYVTCEVAQTTSHPTNPNAHHFRLTAIMAT

Enzyme Prediction     

EC	3.1.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE17	226	378	1.5e-27	0.8909090909090909

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238141	SGNH_hydrolase	5.09e-16	198	388	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	5.10e-06	220	380	11	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
225353	TesA	7.83e-06	228	393	32	212	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].
238863	SGNH_hydrolase_peri1	1.96e-04	249	385	33	181	SGNH_peri1; putative periplasmic member of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238873	SGNH_hydrolase_like_3	0.001	196	386	2	190	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV84988.1|GT90	1.75e-60	152	614	705	1123
QRV99024.1|GT90	2.37e-60	152	614	705	1123
QRW26062.1|GT90	8.22e-55	173	639	351	753
BCJ92770.1|CE17	1.24e-19	182	390	19	211
AEN97394.1|CE17	1.36e-19	167	390	8	211

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HH9_A	3.51e-19	163	390	4	211	Crystal structure of a two-domain esterase (CEX) active on acetylated mannans co-crystallized with mannopentaose [Roseburia intestinalis L1-82],6HH9_B Crystal structure of a two-domain esterase (CEX) active on acetylated mannans co-crystallized with mannopentaose [Roseburia intestinalis L1-82],6HH9_C Crystal structure of a two-domain esterase (CEX) active on acetylated mannans co-crystallized with mannopentaose [Roseburia intestinalis L1-82],6HH9_D Crystal structure of a two-domain esterase (CEX) active on acetylated mannans co-crystallized with mannopentaose [Roseburia intestinalis L1-82]
6HFZ_A	1.18e-17	163	390	4	211	Crystal structure of a two-domain esterase (CEX) active on acetylated mannans [Roseburia intestinalis L1-82],6HFZ_B Crystal structure of a two-domain esterase (CEX) active on acetylated mannans [Roseburia intestinalis L1-82],6HFZ_C Crystal structure of a two-domain esterase (CEX) active on acetylated mannans [Roseburia intestinalis L1-82],6HFZ_D Crystal structure of a two-domain esterase (CEX) active on acetylated mannans [Roseburia intestinalis L1-82]

Swiss-Prot Hits     

I317_07117-t43_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000000

TMHMM  Annotations     

Start	End
79	101