CAZyme Information: I317_07092-t43_1-p1

Basic Information

• Species: Kwoniella heveanensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella heveanensis
• CAZyme ID: I317_07092-t43_1-p1
• CAZy Family: GT69
• CAZyme Description: alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
689		74670.89	4.1522

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KheveanensisCBS569	8002	1296119	131	7871

• Gene Location: location=KV700272:15263-18582(-)

Full Sequence      

MSSCPGSSQTPTNGSLNDTLSAYAALPANVTVGDIETFVEKHFTGEGQDLYQVPIEGFNS
SPALLDNISDPLYKAWTSIVNGYWTLLIRETNQSSICTDQCDSSLIPLNHTVVVPGGRYR
EIYYWDSRWIIEGLLKSELYDYAWDLLQNMMDFIDTYGYIPNGGRQYYLNRSQPPMFIQM
LDAYIKVTGNTTILDRALPLASAEMEWWATNRTFTITSPFTNKTLTVAHYAVNNTAPRPE
GYVEDFETVMGASPALNETARGELYSELATGAESGWDYSSRWCKQPLLNTSDNDPALRTL
NIKAIIPVDLISLLSGDHALLADLYELHGNSSISGNSTDSGSNGNSTTTGGGQTGNSSSS
DPVSYHRQMAQAFSESVLDLCWDPAKSWFYDFNTTSMTRSNVYTPAGAWPLWQNITPSEL
EGNETAALDFVSGARFLLGKYSGIPTVASVLLTGLQWDFPNAWPPHLHTTIKAFETLGRL
LPNATTLSNLTIPFSEVASGQLGVTEGDLQPQPASTIGNVSLEVQEAQGKPWPLALSIEF
ANRYMGAAFCSWYSTGGAIDGLLTQLPLSELNATGTYTAGQSGVMFEKFNSTDTDAAGGG
GEYNVQVGFGWTNGVVLWLADEYGQYLPQPTCPMIPIIEVTGNGNSSTYSNGTTVSGTGP
ISNTTAGGNGTSSQTQTQLFAGFRIPRPE

Enzyme Prediction     

EC	3.2.1.28:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	17	479	1.4e-110	0.835030549898167

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	1.71e-98	17	624	19	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
215307	PLN02567	1.00e-91	10	624	36	545	alpha,alpha-trehalase
224541	TreA	3.28e-61	102	624	151	553	Neutral trehalase [Carbohydrate transport and metabolism].
183936	treA	7.76e-53	80	624	124	537	alpha,alpha-trehalase TreA.
237326	treA	1.02e-50	34	621	93	534	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW44482.2|GH37|3.2.1.28	0.0	11	687	95	760
ADV23702.1|GH37	0.0	7	687	86	756
KGB76251.2|GH37	0.0	11	687	95	761
AFR96750.2|GH37	0.0	11	687	95	761
AUB26705.1|GH37	0.0	11	687	95	761

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7E9U_A	1.81e-54	30	624	74	555	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	2.33e-53	30	624	74	555	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]
2JG0_A	1.90e-47	34	621	59	500	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
5Z66_A	6.83e-46	34	622	96	538	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JF4_A	3.91e-45	34	621	59	500	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54QZ5|TREA_DICDI	2.42e-83	34	632	108	594	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|P19813|TREA_RABIT	1.52e-75	11	631	58	557	Trehalase OS=Oryctolagus cuniculus OX=9986 GN=TREH PE=1 SV=1
sp|A8J4S9|TREA_APIME	8.72e-75	35	627	99	572	Trehalase OS=Apis mellifera OX=7460 PE=1 SV=1
sp|O43280|TREA_HUMAN	1.77e-73	35	627	86	554	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2
sp|Q9JLT2|TREA_MOUSE	7.99e-72	35	631	83	555	Trehalase OS=Mus musculus OX=10090 GN=Treh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000003

TMHMM  Annotations     

There is no transmembrane helices in I317_07092-t43_1-p1.