CAZyme Information: I317_06757-t43_1-p1

Basic Information

• Species: Kwoniella heveanensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella heveanensis
• CAZyme ID: I317_06757-t43_1-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388	KV700259|CGC1	43309.45	6.1389

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KheveanensisCBS569	8002	1296119	131	7871

• Gene Location: location=KV700259:16163-17575(+)

Full Sequence      

MSQETVAPLSLTSERAGELISLLTDGLLHTQDTTGRFLLKLHDGTLVDTKGWEHPTVFSW
EWTHGIALTAFAHVAGAKRSLQVALDWFETQWKRTDGKGAPKNINTMSPFYALACFVEDG
RTKDPKWNGWLDEWAEWIYNDLPKTKEGGFQHMTYVNMHDQNLWDDTLMMSVIPLAKIGK
LLNRPHYIEEAKYQFLIHIKYLADTVSGLWYHGWQFTEDGGHNFAKALWARGNCWITVAI
PMFIEILGDSLPKSDPVYRSLVAAWRRQVDALIRTQDPKTGLWHTLVLDPTSYVEASASA
GFAAGIFLGLRIFGPDAAYQKAAELALSGVINCIQPDGEVSQVSFGTGMGHDLQFYKDIA
ITPMPYGAGLSILALVAWAQLKHAEGAL

Enzyme Prediction     

No EC number prediction in I317_06757-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	49	379	6.5e-100	0.9849397590361446

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	3.80e-79	55	375	29	346	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	4.85e-69	34	376	6	337	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUB22466.1|GH105	8.44e-177	5	386	32	454
AFR92981.1|GH105	8.44e-177	5	386	32	454
AAW41249.1|GH105	7.12e-176	9	383	37	455
ADV19987.1|GH105	9.43e-176	9	383	38	453
KGB75254.1|GH105	4.23e-175	9	383	38	453

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XUV_A	1.54e-115	12	380	4	370	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3QWT_A	8.03e-115	19	378	29	376	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	2.69e-105	19	378	30	377	Chain A, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4WU0_A	9.20e-15	143	332	110	300	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31521|URHG1_BACSU	3.04e-36	58	375	27	332	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
sp|P9WF04|UH105_ALTSL	3.72e-12	164	374	201	404	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000001

TMHMM  Annotations     

There is no transmembrane helices in I317_06757-t43_1-p1.