CAZyme Information: I317_06204-t43_1-p1

Basic Information

• Species: Kwoniella heveanensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella heveanensis
• CAZyme ID: I317_06204-t43_1-p1
• CAZy Family: GT31
• CAZyme Description: oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
451	KV700239|CGC3	50440.87	6.6570

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KheveanensisCBS569	8002	1296119	131	7871

• Gene Location: location=KV700239:74364-76947(-)

Full Sequence      

MSSNNNQAQLSGRVGIVGTGHRARLYTHSIAARPSLELVALCDTNSDRMDHHNQLLKEAG
RPQAKKYAAEDFNKMLEDEKLDILVVTTIDYTHDLYIVPAVKKGIKVLTEKPMTTDVEKC
KKILAAVEEGKGSVQVLFNYRYNPVHWKVAEVIAQGKIGNVKSVHFEWLLDTVHGADYFR
RWHRYKDRSGGLMVHKSSHHFDLVNFWIQSKPESVFGLGSLSFYGKEQGQKSGWARSYDR
ARDSKEAEDDPFAIHLEDEPGLKALYHDAEHIDNYHRDMNVFADDITIEDDMSVLVHYES
GVNMTYHLTAYSPWEGYRVMFNGDKGRLELECVESTHRVPAKKGGDGDGVVHGEKALKNE
GHNKITLQQLWKEKEDVPYVQASGGHGGGDEAMLAQIFGPLPNVKSTETPITGLSANQID
GALAMAVGLAANESFKTGKQVQIKELLGRQL

Enzyme Prediction     

No EC number prediction in I317_06204-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	13	171	2.1e-28	0.40100250626566414

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223745	MviM	6.01e-39	13	226	5	213	Predicted dehydrogenase [General function prediction only].
396129	GFO_IDH_MocA	1.93e-17	13	138	2	120	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
397161	GFO_IDH_MocA_C	2.05e-09	151	443	2	204	Oxidoreductase family, C-terminal alpha/beta domain. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
182305	PRK10206	1.21e-06	71	180	55	156	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYV32364.1|CE9	8.04e-29	13	445	396	753
QOY90270.1|GH0	5.08e-21	15	223	37	254
UPK44969.1|GH0	2.37e-17	13	219	5	202
CEA16880.1|GH0	1.23e-16	2	219	26	259
BBD45948.1|GH0	2.40e-14	14	219	38	262

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ZH8_A	1.63e-13	13	200	20	203	Crystal structure of Oxidoreductase (TM0312) from Thermotoga maritima at 2.50 A resolution [Thermotoga maritima MSB8],1ZH8_B Crystal structure of Oxidoreductase (TM0312) from Thermotoga maritima at 2.50 A resolution [Thermotoga maritima MSB8]
3Q2K_A	1.54e-10	13	216	32	227	Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_B Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_C Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_D Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_E Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_F Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_G Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_H Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_I Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_J Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_K Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_L Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_M Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_N Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_O Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_P Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I]
3EZY_A	3.21e-10	10	221	1	198	Crystal structure of probable dehydrogenase TM_0414 from Thermotoga maritima [Thermotoga maritima],3EZY_B Crystal structure of probable dehydrogenase TM_0414 from Thermotoga maritima [Thermotoga maritima],3EZY_C Crystal structure of probable dehydrogenase TM_0414 from Thermotoga maritima [Thermotoga maritima],3EZY_D Crystal structure of probable dehydrogenase TM_0414 from Thermotoga maritima [Thermotoga maritima]
3MZ0_A	5.72e-10	13	215	4	192	Crystal structure of apo myo-inositol dehydrogenase from Bacillus subtilis [Bacillus subtilis]
3NT2_A	1.02e-09	10	215	1	192	Crystal structure of myo-inositol dehydrogenase from Bacillus subtilis with bound cofactor [Bacillus subtilis],3NT2_B Crystal structure of myo-inositol dehydrogenase from Bacillus subtilis with bound cofactor [Bacillus subtilis],3NT4_A Crystal structure of myo-inositol dehydrogenase from Bacillus subtilis with bound cofactor NADH and inositol [Bacillus subtilis],3NT4_B Crystal structure of myo-inositol dehydrogenase from Bacillus subtilis with bound cofactor NADH and inositol [Bacillus subtilis],3NT5_A Crystal structure of myo-inositol dehydrogenase from Bacillus subtilis with bound cofactor and product inosose [Bacillus subtilis],3NT5_B Crystal structure of myo-inositol dehydrogenase from Bacillus subtilis with bound cofactor and product inosose [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34371|YTET_BACSU	4.15e-67	66	450	57	426	Putative oxidoreductase YteT OS=Bacillus subtilis (strain 168) OX=224308 GN=yteT PE=2 SV=1
sp|O05389|YRBE_BACSU	4.70e-13	15	220	8	199	Uncharacterized oxidoreductase YrbE OS=Bacillus subtilis (strain 168) OX=224308 GN=yrbE PE=3 SV=2
sp|A6KY05|G1092_PHOV8	9.68e-13	13	221	18	216	Glycosyl hydrolase family 109 protein 2 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0611 PE=3 SV=1
sp|Q1AV95|IOLG_RUBXD	2.13e-12	14	219	10	199	Inositol 2-dehydrogenase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1) OX=266117 GN=iolG PE=3 SV=1
sp|Q6M0B9|UGNO_METMP	2.23e-11	14	218	9	191	UDP-N-acetylglucosamine 3-dehydrogenase OS=Methanococcus maripaludis (strain S2 / LL) OX=267377 GN=MMP0352 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000040	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I317_06204-t43_1-p1.