CAZyme Information: I317_05943-t43_1-p1

Basic Information

• Species: Kwoniella heveanensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella heveanensis
• CAZyme ID: I317_05943-t43_1-p1
• CAZy Family: GT20
• CAZyme Description: hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
764	KV700231|CGC1	84785.28	5.5405

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KheveanensisCBS569	8002	1296119	131	7871

• Gene Location: location=KV700231:48930-53079(+)

Full Sequence      

MYVSISGLTTKLIALLNLRSYGDLVDPLLASTLNGRHPSTSLSRNHAVIEIDAGGHRSET
RSRLNIVPAPKYHTTGDGSTPICLASNFAIVFVTSTNSFFSADLEAGGDGDEGGRERTGI
PDDLIRAAGRTQWNVRHHTMKYLSVQGGREFFLTGNDTSAAADTGMDSQQQQQQRYNFSG
GHGPEAKRMNGRCQRYLSTLSIRITDSPFTSGKRGPRSIFEDSTSLPIEERLKLERYELD
IPLNDENGGEGQAILSAPSALGVLRGLTTFEGLWYYLPPPRAQVRVQDRSSVSNADPKTC
FNDSAQDSDHQGCPEGLENDYDEIRYAPFAPYHIRDQAAFGWRGLLLDTSRHFFSVDNIM
RLLDTMSMVKLNIFHWHITDSNSFPLQLHDHPELAQQGAYSPEELYSEADVRRIVRYAGE
RGIDVLFEIDTPGHTASVAASHPDYIACNEAQPWARYAHQPPAGQLRFADEGVVNWTKRL
FDSVAKLSASRYVSTGGDEINVRCMMDDEATVAALSKKGWTLDQALDVFTNATHAALREN
GQTPVVWQEMVLDHGDMPSLKNDTIVEVWVNSSDATKVLDKGYRVVHAASDYFYLDCGHG
SWIGKPSEGGHHESWCDPYKTWSKIYSFDPYEGVKGDQQHLILGGELSLWAEQTDETNLE
STVWPRTAAMAEVFWTGSSSLHKVITPGQDQKASDPEHSEPEPERGTLAKIDLTTADWSS
STILRRMHDTRYRMVDRGIRATPLQPHWCALRPGAVGMSSLSGP

Enzyme Prediction     

No EC number prediction in I317_05943-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	335	677	8.8e-91	0.973293768545994

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119332	GH20_HexA_HexB-like	4.15e-145	340	738	1	348	Beta-N-acetylhexosaminidases catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides. The hexA and hexB genes encode the alpha- and beta-subunits of the two major beta-N-acetylhexosaminidase isoenzymes, N-acetyl-beta-D-hexosaminidase A (HexA) and beta-N-acetylhexosaminidase B (HexB). Both the alpha and the beta catalytic subunits have a TIM-barrel fold and belong to the glycosyl hydrolase family 20 (GH20). The HexA enzyme is a heterodimer containing one alpha and one beta subunit while the HexB enzyme is a homodimer containing two beta-subunits. Hexosaminidase mutations cause an inability to properly hydrolyze certain sphingolipids which accumulate in lysosomes within the brain, resulting in the lipid storage disorders Tay-Sachs and Sandhoff. Mutations in the alpha subunit cause in a deficiency in the HexA enzyme and result in Tay-Sachs, mutations in the beta-subunit cause in a deficiency in both HexA and HexB enzymes and result in Sandhoff disease. In both disorders GM(2) gangliosides accumulate in lysosomes. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
395590	Glyco_hydro_20	3.98e-104	340	677	1	345	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
119333	GH20_chitobiase-like	7.03e-67	340	677	1	344	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
119338	GH20_chitobiase-like_1	9.63e-56	340	676	1	297	A functionally uncharacterized subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the chitobiase of Serratia marcescens, a beta-N-1,4-acetylhexosaminidase that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This subgroup lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
119331	GH20_hexosaminidase	1.24e-55	342	675	1	302	Beta-N-acetylhexosaminidases of glycosyl hydrolase family 20 (GH20) catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides. These enzymes are broadly distributed in microorganisms, plants and animals, and play roles in various key physiological and pathological processes. These processes include cell structural integrity, energy storage, cellular signaling, fertilization, pathogen defense, viral penetration, the development of carcinomas, inflammatory events and lysosomal storage disorders. The GH20 enzymes include the eukaryotic beta-N-acetylhexosaminidases A and B, the bacterial chitobiases, dispersin B, and lacto-N-biosidase. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by the solvent or the enzyme, but by the substrate itself.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV22857.1|GH20	3.77e-217	57	755	22	581
AUB25806.1|GH20	1.73e-215	64	755	29	581
AFR95944.1|GH20	1.73e-215	64	755	29	581
UOH82094.1|GH20	1.98e-214	64	755	29	581
AAW44323.1|GH20	9.07e-213	64	755	29	581

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S6T_A	1.11e-66	333	754	183	571	Crystal Structure of insect beta-N-acetyl-D-hexosaminidase OfHex1 V327G complexed with PUGNAc [Ostrinia furnacalis]
3NSM_A	1.44e-66	333	754	180	568	Crystal Structure of insect beta-N-acetyl-D-hexosaminidase OfHex1 from Ostrinia furnacalis [Ostrinia furnacalis],3NSN_A Crystal Structure of insect beta-N-acetyl-D-hexosaminidase OfHex1 complexed with TMG-chitotriomycin [Ostrinia furnacalis],3OZO_A Crystal Structure of insect beta-N-acetyl-D-hexosaminidase OfHex1 complexed with NGT [Ostrinia furnacalis],3OZP_A Crystal Structure of insect beta-N-acetyl-D-hexosaminidase OfHex1 complexed with PUGNAc [Ostrinia furnacalis]
3WMB_A	1.94e-65	333	754	180	568	Crystal structure of insect beta-N-acetyl-D-hexosaminidase OfHex1 complexed with naphthalimide derivative Q1 [Ostrinia furnacalis],3WMC_A Crystal structure of insect beta-N-acetyl-D-hexosaminidase OfHex1 complexed with naphthalimide derivative Q2 [Ostrinia furnacalis]
5Y1B_A	2.20e-65	333	754	180	568	Crystal Structure of insect beta-N-acetyl-D-hexosaminidase OfHex1 complexed with a berberine derivative (SYSU-00679) [Ostrinia furnacalis]
5Y0V_A	5.81e-65	333	754	180	568	Crystal Structure of insect beta-N-acetyl-D-hexosaminidase OfHex1 complexed with berberine [Ostrinia furnacalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9SYK0|HEXO2_ARATH	9.30e-91	225	754	107	568	Beta-hexosaminidase 2 OS=Arabidopsis thaliana OX=3702 GN=HEXO2 PE=1 SV=1
sp|D4AUH6|HEX1_ARTBC	1.76e-75	235	684	157	566	Beta-hexosaminidase ARB_07893 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07893 PE=1 SV=1
sp|P49010|HEXC_BOMMO	5.15e-70	334	754	205	592	Chitooligosaccharidolytic beta-N-acetylglucosaminidase OS=Bombyx mori OX=7091 PE=1 SV=1
sp|E9DFH0|HEX1_COCPS	1.28e-67	325	753	162	582	Beta-hexosaminidase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=HEX1 PE=1 SV=1
sp|Q8WSF3|FDL_DROME	1.26e-66	329	754	265	657	Probable beta-hexosaminidase fdl OS=Drosophila melanogaster OX=7227 GN=fdl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000001

TMHMM  Annotations     

There is no transmembrane helices in I317_05943-t43_1-p1.