CAZyme Information: I317_05679-t43_1-p1

Basic Information

• Species: Kwoniella heveanensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella heveanensis
• CAZyme ID: I317_05679-t43_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
520		57946.93	7.3179

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KheveanensisCBS569	8002	1296119	131	7871

• Gene Location: location=KI669538:64179-66100(-)

Full Sequence      

MFPGLFPSHSSPSDVLSPPEPVLGQKYAPYISLMIPVLLAPWTLMFVLMIRQVTLRPMKE
KTVTILVVGDIGRSPRMMYHASSFAKKGWQVFLIGYKETKPILDLIDNPLVKIYDLLEPP
SLLSSFPWILRAPIRVFYQVYSIIQLAIWEIPVNTEVLLVQNPPSIPTLPVAQLISFASD
AKLFVDWHNTGYSILGLRVGKNNPLTKIALGIERLFGGSAWAHLFVTKALEQYLATDWNL
QGRRAVLHDRPPSHFHRTTPAVQHELFHRLSSLISSSLPANLRNKSSAENDSTPFTELSS
TKEPVLRSDRPALVVSSTSWTADEDFSLLVTALDAYQAAITKFSKGKSTRLPKLIVLITG
KGALRSSFEKTVAQREKTTWKDVTARCIFLPAEDYPVLLGSADLGVSLHTSSSGRDLPMK
VVDMFGCGTPVLAKGFGCIGELVKEGKNGRIFRNGEELGEQLIEVLESFPEAPQLVELQS
YFHGNGQKEAVDGFHAEWNTWDENWDKVVDEGLLSKLERD

Enzyme Prediction     

EC	2.4.1.142:10	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT33	61	510	6.1e-147	0.9905882352941177

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340843	GT33_ALG1-like	0.0	58	509	1	407	chitobiosyldiphosphodolichol beta-mannosyltransferase and similar proteins. This family is most closely related to the GT33 family of glycosyltransferases. The yeast gene ALG1 has been shown to function as a mannosyltransferase that catalyzes the formation of dolichol pyrophosphate (Dol-PP)-GlcNAc2Man from GDP-Man and Dol-PP-Glc-NAc2, and participates in the formation of the lipid-linked precursor oligosaccharide for N-glycosylation. In humans ALG1 has been associated with the congenital disorders of glycosylation (CDG) designated as subtype CDG-Ik.
215155	PLN02275	7.86e-127	59	466	3	371	transferase, transferring glycosyl groups
340831	GT4_PimA-like	5.80e-08	72	508	15	364	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
223515	RfaB	1.30e-07	126	510	55	372	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
395425	Glycos_transf_1	6.47e-07	350	468	30	144	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV19846.1|GT33	5.63e-197	41	519	29	506
AAW41187.1|GT33	1.13e-196	41	519	29	506
KGB75402.1|GT33	6.49e-196	41	519	29	506
AUB22294.1|GT33	2.45e-193	41	519	29	506
AFR92818.1|GT33	2.45e-193	41	519	29	506

PDB Hits     

I317_05679-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q921Q3|ALG1_MOUSE	1.79e-89	59	509	31	457	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Mus musculus OX=10090 GN=Alg1 PE=1 SV=3
sp|Q5R7A2|ALG1_PONAB	5.96e-89	63	509	35	457	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Pongo abelii OX=9601 GN=ALG1 PE=2 SV=1
sp|Q9BT22|ALG1_HUMAN	8.39e-89	63	509	35	457	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Homo sapiens OX=9606 GN=ALG1 PE=1 SV=2
sp|Q8L7M0|TUN_ARATH	1.60e-85	59	470	3	421	UDP-glycosyltransferase TURAN OS=Arabidopsis thaliana OX=3702 GN=TUN PE=2 SV=1
sp|P90522|ALG1_DICDI	7.88e-79	63	470	4	418	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000039	0.000004

TMHMM  Annotations     

Start	End
28	50