CAZyme Information: I317_05675-t43_1-p1

Basic Information

• Species: Kwoniella heveanensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella heveanensis
• CAZyme ID: I317_05675-t43_1-p1
• CAZy Family: GT2
• CAZyme Description: glyoxal oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
671		71729.11	4.1526

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KheveanensisCBS569	8002	1296119	131	7871

• Gene Location: location=KI669538:50587-52815(+)

Full Sequence      

MTSINLLSLLPLLPLLALVSATPASWPIVHRDPAAPPLNYLGKRQATNGTATPLSFESVG
DTGVSAQMVFLGNNKKIYVLDKTENNPIEITGKYGTHPAWATEYDIETNEYRTMDVFSNT
FCAGGGVLGNGTWVVFGGNQPVTTGGVASTDAAAYSDTDGGTAIRMLNPCTDESCEYIQG
ETSYLTTDANTGGWLQMTGRRWYPMVEALPDGSLIIIGGDKNGGYVNTEAQDNPTYEFFP
PRDDDPVDLQFLADTLPINLYALTWLMPSGKLFMQANRKTILYDYDTKETTDLPDMPYAA
RVYPASAATAMLPLIPDNDYAATLLFCGGSNPPQWGNDGTAGYNVTAIAADNTCVRITPE
GSAKYEDDDYMLEGRSMGQFVILPDSTFWMGNGVAMGTAGYGDDGYSVGQSYGQAPLYIP
AIYNASAPAGTRWNRTGLSASDNERMYHSVAILLPDGSIFIAGSNPNKDFTSTQWRSRTD
SERWYPWYYNEKRPEYDGMPDALSYGGASFNLTMVGTDEAAAKNTKVVVIRGGFNTHAIG
FGQRYLQLNSTYEVDMNTGNTTLIVSQMPGTNGPNLFQPGPAMFFVVVNGVPSQGEFVMI
GNGKLGTQPTATNDPLPAATLIEKPVETTADTTGAATQGASAGSSSSASQVAIIALGSTV
IAALASIAVFL

Enzyme Prediction     

No EC number prediction in I317_05675-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA5	51	620	4.3e-221	0.9875666074600356

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399910	Glyoxal_oxid_N	5.02e-44	67	329	2	243	Glyoxal oxidase N-terminus. This family represents the N-terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes. Glyoxal oxidase catalyzes the oxidation of aldehydes to carboxylic acids, coupled with reduction of dioxygen to hydrogen peroxide. It is an essential component of the extracellular lignin degradation pathways of the wood-rot fungus Phanerochaete chrysosporium.
401164	DUF1929	9.36e-25	500	600	3	91	Domain of unknown function (DUF1929). Members of this family adopt a secondary structure consisting of a bundle of seven, mostly antiparallel, beta-strands surrounding a hydrophobic core. The 7 strands are arranged in 2 sheets, in a Greek-key topology. Their precise function, has not, as yet, been defined, though they are mostly found in sugar-utilising enzymes, such as galactose oxidase.
199882	E_set_GO_C	1.39e-20	488	600	1	103	C-terminal Early set domain associated with the catalytic domain of galactose oxidase. E or "early" set domains are associated with the catalytic domain of galactose oxidase at the C-terminal end. Galactose oxidase is an extracellular monomeric enzyme which catalyzes the stereospecific oxidation of a broad range of primary alcohol substrates and possesses a unique mononuclear copper site essential for catalyzing a two-electron transfer reaction during the oxidation of primary alcohols to corresponding aldehydes. The second redox active center necessary for the reaction was found to be situated at a tyrosine residue. The C-terminal domain of galactose oxidase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB79344.2|AA5_1	0.0	36	622	20	610
UOH82708.1|AA5_1	0.0	1	622	1	617
ADV22716.1|AA5_1	0.0	43	622	36	615
AFR95790.1|AA5_1	0.0	1	622	1	617
AUB25635.1|AA5_1	0.0	1	622	1	617

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UNM_A	3.59e-15	197	600	253	614	Structure of Galactose Oxidase homologue from Streptomyces lividans [Streptomyces lividans],4UNM_B Structure of Galactose Oxidase homologue from Streptomyces lividans [Streptomyces lividans]
5LXZ_B	1.73e-13	197	600	242	603	W288A mutant of GlxA from Streptomyces lividans: Cu-bound form [Streptomyces lividans TK24]
5LQI_A	1.75e-13	197	600	247	608	W288A mutant of GlxA from Streptomyces lividans: apo form [Streptomyces lividans 1326],5LQI_B W288A mutant of GlxA from Streptomyces lividans: apo form [Streptomyces lividans 1326]
2EIB_A	2.02e-08	188	600	254	637	Chain A, Galactose oxidase [Fusarium graminearum]
2EID_A	2.66e-08	188	600	254	637	Chain A, Galactose oxidase [Fusarium graminearum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01772|GLOX_PHACH	7.60e-68	62	603	35	552	Aldehyde oxidase GLOX OS=Phanerodontia chrysosporium OX=2822231 GN=GLX PE=1 SV=1
sp|Q3HRQ2|GLOX_VITPS	3.10e-43	105	600	80	521	Aldehyde oxidase GLOX OS=Vitis pseudoreticulata OX=231512 GN=GLOX PE=2 SV=1
sp|Q9FYG4|GLOX1_ARATH	4.44e-41	105	600	162	614	Aldehyde oxidase GLOX1 OS=Arabidopsis thaliana OX=3702 GN=GLOX1 PE=2 SV=1
sp|A0A2H4HHY6|GLOX_ARTAN	3.49e-32	61	600	76	593	Putative aldehyde oxidase Art an 7 OS=Artemisia annua OX=35608 PE=1 SV=1
sp|D4AUF1|WSCD1_ARTBC	3.13e-28	71	617	437	922	WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07867 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000322	0.999640	CS pos: 21-22. Pr: 0.9746

TMHMM  Annotations     

Start	End
648	670