CAZyme Information: I317_05636-t43_1-p1

Basic Information

• Species: Kwoniella heveanensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella heveanensis
• CAZyme ID: I317_05636-t43_1-p1
• CAZy Family: GT2
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
841	KV700223|CGC1	92111.93	5.0129

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KheveanensisCBS569	8002	1296119	131	7871

• Gene Location: location=KV700223:47570-51675(+)

Full Sequence      

MATSDIINPEEVLKQLSSEEKIALLSGDDMWHTVPVPRLGVPRVRNGVRGTAWTNGAPAS
CFPSATGLAASMDVDLVRRIGEALGEECRARGVHCLLGPTTNCQRHPCGGRGFESYSEDP
YLCGHIALAWIEGVQSKKVMTNYLANEQEYLRRSNNSVIDERTMHEIYLEPFRLQCKAKP
SVFMSSYNRVNGLHVAEHPYLLRKVLRGDFGFEGMIMSDWSGTYSSSEAIKASLDLEMPG
PAMMRGVSLERDIVGGKLVPEDLDECVLRVLHYVREAQESGIAFEKEEDTIDTPAIRALL
REAADSAVVLLKNSANSLPISAPKGKKIAVIGPNARTASYAGGGSANLAPTYLVTPLEAI
KKQAEELGAEIEYTIGADSSRWTPLLTPFISHPRKTPADGPGVDIDFYDTNPWETEAKSL
FNKFNNSAFSYFIDGIPKEVPVRGYVSLKTVFTPDESGVWELGLGVAGQADLYIDGKKVI
DNSSDQKAGLLFFNTGAEERTGEVEVEAGRAYNLEVRFSNFKQLNAMSPYTGRRGGIRIG
GRPKRSAASEIEKAVNLAKESDVTIVVIGTNSEWESESYDRDDMKLPPGVDDLVRSLLSV
NPNSIIVNQSGMPVELPWIEQASTVVQAFFGGNECGTAIADALFGRINPSGKLPVTWATK
VEDFPSHETFGEPINTVYKEGVNVGYRYFDRAQNPRSAFPFGHGLSYTSFKLSDLSVNAD
GFGAKTSFTITNTGKITGAETAQVYVHDQSPILERPEIELGGFVKIELQAGESKQVEVTL
DHKAFSFYSVQEKAWVGKAGDFEIRVGTSSTKIELSKPFHLDQTFKWVGLQEPQPFTLFT
A

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	37	239	9.1e-53	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.18e-77	62	814	120	758	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	8.96e-51	308	686	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
224389	BglX	1.12e-50	29	371	48	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	4.10e-33	16	793	60	756	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	7.29e-28	62	271	88	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFR98487.2|GH3	0.0	1	836	1	844
AUB28642.1|GH3	0.0	1	836	1	844
ADV25102.1|GH3	0.0	1	836	1	840
UOH85351.1|GH3	0.0	1	841	1	838
KNX49905.2|GH3	0.0	1	836	1	844

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	6.39e-187	10	830	7	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.75e-182	10	830	7	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	7.40e-127	7	826	3	673	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	6.37e-101	13	836	9	678	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	9.67e-88	11	813	56	820	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U8Y5|BGLI_ASPOR	5.78e-207	7	830	4	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|Q5BB53|BGLI_EMENI	2.30e-206	7	830	4	839	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2
sp|B8NDE2|BGLI_ASPFN	3.65e-205	7	830	4	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|A1DFA8|BGLI_NEOFI	1.77e-202	7	830	4	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|Q0CAF5|BGLI_ASPTN	1.83e-202	7	830	4	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000002	0.000044

TMHMM  Annotations     

There is no transmembrane helices in I317_05636-t43_1-p1.