CAZyme Information: I317_05600-t43_1-p1

Basic Information

• Species: Kwoniella heveanensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella heveanensis
• CAZyme ID: I317_05600-t43_1-p1
• CAZy Family: PL14
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
530	KV700222|CGC1	58934.57	4.7931

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KheveanensisCBS569	8002	1296119	131	7871

• Gene Location: location=KV700222:64839-66898(+)

Full Sequence      

MVAQSQASWLSQLRTQKYSLLPSNSSPPTPDLRGSSSSSNGGGAVNVSISFRKRLFIASI
FALAFIGTTGYTLRSSVSSRIVAQPYRHGLDSNPDSGWSENPSSSSEEDELTTDDDGDDN
DASSAGIEEMWGLSEGEGWAPPRDSGLADLGEVAEGRYRLNTEPGEEGSRAYFARLYDFA
ISLPMALHVPLLTSLYTHAPPRYPSTVPSPPFMPDWKKPSPAMISYKTIHQTDKTYNPDN
ELTQEWKAMNEADGWELNFMDDGAAQGWLENLFGGSQVEWAWNFMHRGVLKADFLRYILP
LVLGGVYSDVDTRPIRPIEQWGQTNVEYLSLASTDGLNWRSKLSTHPAVIVAIDVDVHSY
PHWENSWPRPLGICQWTLSSAPSHPIFLDAVRRVVNASHVVQDWENWRTDEIQRLDGEGR
SQEAKELADQHRDHAMNVMEWTGPGLFTDSVLAYILARYNVTWHRLRGLDHPLRIGDVLI
LPITGFSPGGQPDFKAEGPDSPQANVLHNCKFSTASLACTVRGDHFESLM

Enzyme Prediction     

No EC number prediction in I317_05600-t43_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.54e-11	219	489	77	322	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.24e-06	268	322	42	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUB26041.1|GT32	3.08e-190	48	516	35	497
AFR96155.2|GT32	3.08e-190	48	516	35	497
ADV23039.1|GT32	1.54e-185	9	516	6	497
UOH81886.1|GT32	2.18e-185	9	516	6	497
KGB75873.1|GT32	2.26e-185	9	516	6	488

PDB Hits     

I317_05600-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	4.39e-34	260	508	177	387	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	1.65e-25	281	508	161	369	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	1.03e-21	225	508	116	463	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P47124|HOC1_YEAST	6.39e-18	289	493	196	368	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999870	0.000135

TMHMM  Annotations     

Start	End
55	77