CAZyme Information: I317_05079-t43_1-p1

Basic Information

• Species: Kwoniella heveanensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella heveanensis
• CAZyme ID: I317_05079-t43_1-p1
• CAZy Family: GH72
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
695	KI669535|CGC1	77424.61	6.0915

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KheveanensisCBS569	8002	1296119	131	7871

• Gene Location: location=KI669535:18442-20529(+)

Full Sequence      

MTIAAPMTNGEATKWFHKPFSMYQTNLREIDADMDVEKAAQFISDYGVHAWLFGVGGIQA
QYPTSLSFQEINPNLTKRASGDLVGDAIKVAKAKGLKILARMDFSKVAPRVADEHPDWLY
RSPKGDLQTHTADLVSVCPSGEYYQERMFDIINEVCERYDLDGFFFNWMSMNEIDYDQVY
HGVCHCGNCEKRWADFNKGSEHASTPLPNGPDDEAYPRWVVFSEEVIDDVIGRIRGFIAA
RKPNAGLILGQTADIMFHEANNAVGRELWHSATSEWVGSWKSFRPSVPAIANSTTFIDMP
YRMAPENPEHFAQYLVQCISRGGNPSTYSMGTPLRIPYTCYDYGREITRFHRKWINVYDG
LTPVAKTGLVRPGRTLLVAQKYNEAVKEFRGLYSAMKERHIPFDVLPQERLQDMESNGSL
ARYQRIIFGDIGRFAPGDGTVLDKWVAAGGKLLLTGSSGVNVDNSTQLESHPASRLISVL
EDRRKLFNTYIAPEDSVDKTDPHTYHGFIAPIYGAHQHFELKSDRQIETYAKVLDRAPFA
PPEYAYGNKAHPDEGGAVIAAFGQGTTAIIPFTIGRAYKDLGLTPLRDFFLDVLTNKLSA
PEILSFDIAEQVEITVNRNGKDLIVHLDNQSGARPTNFGPYLPIAGGKITINGAQSSSSI
TAHALYADQEVQVKNGEIVLPVLGLFEVVVIKGVL

Enzyme Prediction     

No EC number prediction in I317_05079-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH151	62	167	9.9e-16	0.7633587786259542

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
405546	GHL6	2.34e-28	35	168	1	135	Hypothetical glycosyl hydrolase 6. GHL6 is a family of hypothetical glycoside hydrolases.
153237	A4_beta-galactosidase_middle_domain	1.04e-08	388	490	27	123	A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to beta-galactosidase from Thermus thermophilus. Beta-Galactosidase hydrolyzes the beta-1,4-D-galactosidic linkage of lactose, as well as those of related chromogens, o-nitrophenyl-beta-D-galactopyranoside (ONP-Gal) and 5-bromo-4-chloro-3-indolyl-beta-D-galactoside (X-gal). This A4 beta-galactosidase middle domain lacks the catalytic triad of typical GATase1 domains. The reactive Cys residue found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow in typical GATase1 domains is not conserved in this group.
224786	GanA	5.43e-05	81	460	67	495	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
251441	GHL10	2.43e-04	82	244	70	222	Glycosyl hydrolase-like 10. This is family of bacterial glycosyl-hydrolase-like proteins falling into the family GHL10 as described above,.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUX28077.1|GH0	2.44e-188	15	690	7	667
BBY87249.1|GH0	3.36e-184	4	693	3	687
QYN36147.1|GH0	3.23e-182	15	691	10	646
QUH01838.1|GH0	5.78e-180	10	693	7	671
QSE89808.1|GH0	1.61e-174	15	688	31	691

PDB Hits     

I317_05079-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

I317_05079-t43_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000039	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I317_05079-t43_1-p1.