CAZyme Information: I317_04923-t43_1-p1

Basic Information

• Species: Kwoniella heveanensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella heveanensis
• CAZyme ID: I317_04923-t43_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360		41118.51	6.3446

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KheveanensisCBS569	8002	1296119	131	7871

• Gene Location: location=KV700210:72411-74110(-)

Full Sequence      

MSRRRASAADIFQPSRRILRFCALSFLIIAGLWVLSSRSDLDLHSGSSIRSESWGYLNGK
RQVDQASFAAPEQHPIDSFVQTFPKLRKFDQLEPLGHQDEGIIERTEGNESQTGRTPFDW
PRTKKLFVFGDSYLKITERMVLMGVTIKNSVFHDFHVLQYWNFAKPGATVSHSVLPPGLE
SYGTYETQINDFEELFTPAPGPRNVNWQSNDTLFVVFFGINDMRDDLHEGEGLDIPSTTK
ALADSLLVSTRRLYSVGARSFLFLTLPPIQYSPKYNLPGQVGHDIQHRVDHSVSSYNAFL
RKAVDDFEQEQTDANVMLFDLEKYWRLILDYPELFGMTDCARFAMTVDGKRPNLGRMGLW

Enzyme Prediction     

No EC number prediction in I317_04923-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	158	342	4.7e-33	0.6704119850187266

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	4.15e-27	125	339	1	223	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	4.22e-08	162	339	79	260	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
395531	Lipase_GDSL	4.38e-07	126	340	1	209	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA08891.1|CE16	2.50e-21	123	343	29	263
CCD57092.1|CE16	4.93e-18	152	349	115	297
CCA73365.1|CBM1|CE16	7.33e-18	157	344	153	332
ATZ51220.1|CBM1|CE16	7.33e-18	152	349	152	334
CCD48175.1|CE16	1.09e-16	124	343	31	264

PDB Hits     

I317_04923-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QJ27|AES1_MYCTT	2.47e-10	123	350	31	271	Acetylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=aes1 PE=3 SV=1
sp|T2FKR1|AES1_THETO	2.47e-10	123	350	31	271	Acetylesterase OS=Thermothelomyces thermophilus OX=78579 GN=aes1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999988	0.000032

TMHMM  Annotations     

Start	End
17	36