CAZyme Information: I317_04855-t43_1-p1

Basic Information

• Species: Kwoniella heveanensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella heveanensis
• CAZyme ID: I317_04855-t43_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
478	KV700209|CGC1	49915.90	4.1660

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KheveanensisCBS569	8002	1296119	131	7871

• Gene Location: location=KV700209:142227-144193(-)

Full Sequence      

MLSKTILVPLFFATFSQASVLRPRQSAEKAIMYEYGHDPSTTTSIDYGDDPAAAWLAAHP
EIEKPSTYDWQAAQSTDLDVAPTVDATSADYQSAPTVVSAPGESSIPPVPTSSDVPTASS
LASPPTSSVAAVESSVASPPSPPGSSVSVSAAPTSSVGYGQPPPPVSSTAIVSAPEGTNG
ARPTVTGEEHTDAPPQATDGCSCGYTLTDYDNRYYPEKTVLHFSTVPDGADLTQYGFYVN
DGDSAGPASTTEPGRRCVGSAENVYVQGGVLHLKVPAGQAGSTSPTGAELIFNPDVTGGL
FVMEAQVDATPGTCMSIHTYTKVAGTSDEIDIEVLGQTIFEDLPPNFKGMGLSNYEPGGS
KAGNHSEFPNDPTQGFNRYGIGWFNDGPRFFYNDAPTAKQPEIKIPTNKCSIIINNWTNG
DPTFTQGPPATDSILKVRKIEYYYSVGETTVYPALKDSCTVESACPVSGGAAVVSASR

Enzyme Prediction     

No EC number prediction in I317_04855-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	270	443	3.2e-20	0.921875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	1.78e-20	228	443	4	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	1.96e-08	257	431	27	202	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
395585	Glyco_hydro_16	2.88e-07	259	427	1	160	Glycosyl hydrolases family 16.
236766	rne	0.001	39	197	850	1008	ribonuclease E; Reviewed
236776	PRK10856	0.002	71	172	157	255	cytoskeleton protein RodZ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFR97245.2|GH16	5.64e-37	198	467	140	417
AUB27240.1|GH16	5.64e-37	198	467	140	417
AAW45658.2|GH16	5.85e-37	201	467	145	419
KGB76706.2|GH16	4.30e-35	198	467	130	407
UOH83268.1|GH16	8.13e-28	201	429	133	384

PDB Hits     

I317_04855-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

I317_04855-t43_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000429	0.999558	CS pos: 24-25. Pr: 0.5314

TMHMM  Annotations     

There is no transmembrane helices in I317_04855-t43_1-p1.