CAZyme Information: I317_04757-t43_1-p1

Basic Information

• Species: Kwoniella heveanensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella heveanensis
• CAZyme ID: I317_04757-t43_1-p1
• CAZy Family: GH5
• CAZyme Description: phosphatidylinositol glycan, class M

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
572		63103.61	9.6283

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KheveanensisCBS569	8002	1296119	131	7871

• Gene Location: location=KI669531:125321-127710(+)

Full Sequence      

MAPSSLSYNADANDDKTSPNKPQDRDASTSQSSSKRKLTTTHLLVLSFLIQVGLLLYANH
IDNHPERYGGLKYTDVDWRVVSDGAKLIFNPDEEDGNIARGWLMRYLGLKIGDPYERATF
RYTPLLPLLISPSLFHPLLGRLLLVLISLYISPLLLSLPTSDLTFTPTSAQTFSAVYAPG
SRSLSTSASPSSSLPQPFAHPARSQCSFWSVHLLWTLNPFVLNITTRGSPESIICLLVIV
LLVALRKGREIQAAIWLGLAVSWKIYPAIYVPAIWSFLARPGSRRESKPTTAQQYSGGDR
DHGGWLGWRVWRFGTVAGVTFGVVNGILWAIWGQPFLEHTYLYHLTRQDHRHNFSPYFYP
IYLSFYNSANHNTSIIPALNTPSTSTPTPTPMTGSVVSDLISRIVRNPLTSFLPQLSLVL
LSGFGLESATRSATTESTEIGKGSSNLETAMFVQTAAFVVFNKVCTSQYFMWFLPLLPPI
LSSLTSLSLSRRKIAILVGSWVIAQAVWLATAYQLELMGRSVYLAVWAGGLSLFGVSIWV
LGELIDAFGAAVVEQRSARVANGVNGVREKVE

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	224	545	2.3e-83	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
252941	Mannosyl_trans	9.65e-54	224	545	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.
178434	PLN02841	7.92e-48	33	570	1	440	GPI mannosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB75735.1|GT50	4.54e-153	40	548	6	411
AUB22890.1|GT50	1.25e-152	40	548	6	411
AFR93356.1|GT50	1.25e-152	40	548	6	411
UOH81399.1|GT50	2.50e-152	40	548	6	411
ADV19492.1|GT50	5.37e-152	40	560	6	423

PDB Hits     

I317_04757-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I073|GPI14_GIBZE	3.90e-54	38	546	8	406	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1
sp|Q2TXB8|GPI14_ASPOR	8.78e-48	47	546	15	408	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q4WAH2|GPI14_ASPFU	1.48e-46	47	551	15	424	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1
sp|Q7S4Z3|GPI14_NEUCR	7.03e-46	43	545	29	482	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1
sp|Q54IA4|PIGM_DICDI	1.42e-44	40	545	25	427	GPI mannosyltransferase 1 OS=Dictyostelium discoideum OX=44689 GN=pigm PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999986	0.000034

TMHMM  Annotations     

Start	End
38	57
138	160
224	246
253	275
310	332
494	513
523	545