CAZyme Information: I317_04122-t43_1-p1

Basic Information

• Species: Kwoniella heveanensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella heveanensis
• CAZyme ID: I317_04122-t43_1-p1
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
469	KV700199|CGC1	51934.59	5.4365

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KheveanensisCBS569	8002	1296119	131	7871

• Gene Location: location=KV700199:54312-56577(-)

Full Sequence      

MQWFRKAPKGKDGGIRLGDGASAGGEGGKGDRPRLMVAHFMLGNTYPFTDKDWETTLDLA
EATSLDALVLNLGPEDWQLRQAQRAYSLVAAPKRDIKLFLSLDMNVLPPDPAVLVDKVLQ
IVGGGNAAQLRWGGGIVLSTFSGQQMDAGWRDVIAGVEQGLGEKVFFWPSLFLPPHEILA
KDYVHGAFHWNGAWPMGNYTTDLDEDRAFLRHDKPYMAAVSPLFFTHYGTEGQWAWNKNW
IYRSDDLLLPTRFQQLLSLPTEQAPSIIQVISWNDYGESHYIAPILGAQPGSESWTEGMD
HQGFRWLVSFFARKWRDGASDIEALQSTGRVVLWYRPQSKSMTDSVDAVAKPEHAEWAQD
LLNFFIVVPGDPSTPTTYTLTVLNGAQQNLSTMKFKDGEVVLHAIPYVPGPVRFEITDDR
ARVLISGDGKDITISGLGDGKHGEGGGGSKGWNYNMWSKVYRGVESGTG

Enzyme Prediction     

EC	3.2.1.59:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH71	37	423	1.8e-92	0.984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397634	Glyco_hydro_71	1.89e-109	37	424	2	371	Glycosyl hydrolase family 71. Family of alpha-1,3-glucanases.
211418	GH71	6.81e-68	32	311	3	276	Glycoside hydrolase family 71. This family of glycoside hydrolases 71 (following the CAZY nomenclature) function as alpha-1,3-glucanases (mutanases, EC 3.2.1.59). They appear to have an endo-hydrolytic mode of enzymatic activity and bacterial members are investigated as candidates for the development of dental caries treatments.The member from fission yeast, endo-alpha-1,3-glucanase Agn1p, plays a vital role in daughter cell separation, while Agn2p has been associated with endolysis of the ascus wall.
211414	GH99_GH71_like	5.36e-15	37	307	2	276	Glycoside hydrolase families 71, 99, and related domains. This superfamily of glycoside hydrolases contains families GH71 and GH99 (following the CAZY nomenclature), as well as other members with undefined function and specificity.
211416	GH99_GH71_like_3	0.003	179	284	204	309	Uncharacterized glycoside hydrolase family 99-like domain. This family of putative glycoside hydrolases resembles glycosyl hydrolase families 71 and 99 (following the CAZY nomenclature) and may share a similar catalytic site and mechanism.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB74802.1|GH71	3.57e-162	2	458	7	451
AUB24825.1|GH71	2.85e-161	2	458	29	471
AUB24826.1|GH71	2.85e-161	2	458	29	471
AGV14343.1|GH71	2.85e-161	2	458	29	471
AFR95081.2|GH71	2.85e-161	2	458	29	471

PDB Hits     

I317_04122-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13716|AGN1_SCHPO	8.79e-55	34	368	22	349	Glucan endo-1,3-alpha-glucosidase agn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=agn1 PE=1 SV=2
sp|B6GX22|MU71A_PENRW	1.40e-37	34	435	36	417	Mutanase Pc12g07500 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=PCH_Pc12g07500 PE=1 SV=1
sp|O94510|AGN2_SCHPO	2.85e-36	34	389	11	372	Ascus wall endo-1,3-alpha-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=agn2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000001

TMHMM  Annotations     

There is no transmembrane helices in I317_04122-t43_1-p1.