CAZyme Information: I317_03860-t43_1-p1

Basic Information

• Species: Kwoniella heveanensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella heveanensis
• CAZyme ID: I317_03860-t43_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
738	KV700194|CGC1	81881.98	6.1375

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KheveanensisCBS569	8002	1296119	131	7871

• Gene Location: location=KV700194:151504-154252(-)

Full Sequence      

MPSFTPKPKLHIPISEKTSPFFSSPYDPNAHHSSSSSQQLSPLPSTSDISSKGEGEIDSQ
TPLLPPSPAMLEKGRGSYPFPSSHTSRLKRMRMAWRNGLPGGMVKRVAVLTLVLALAVLT
LHQGSTRFIAPRVSTSGSDFASSAAAARLPKVSGRPFKFPSFLPSSDVTGARTGTQPPGG
GSKGLREIDISSDSLPVEATLRERLDVWKNAPGGRGEIKGEIEHGGFVQWSLEQCDTISE
QHNTHMIQHSANVWASVNRTSLHQYRMDLIDHMEHVLAEGLTEQYGEGRGIVMVAGNADT
LTRVKWSLQMLRSYGSTLPVQIYHFPSERPADDSPLRTELQDLGAELVEAAGQEKDKGKT
KSYHLKAIAVVQSPFREVLYLDSDSIPTRDPEYMFDAPNYKRLGIFATPDYWKTSANNPI
WAIMGVKCRNEWEMETGQMFVDKKMHLDVFLLIQYMLERHDFWFYFSDGDKDIFRWALLA
LRKRWAVPGRWVGAAALPSGTASGDFCAHTMLQHDSWGEPLFVHYNLLKQIPSGVGRGYS
WGRTKQMPLFNTWPATPATARLGEPEYKPSDDDKPGLGDTDCDMLADADEHGRARAEAKE
MIMRRAARERGIKVRYHGGWISALCIDLDYIDPRPEERKEEDAARKALLEEQAALAASAL
SSDSGSSSTSDDESQPKDAAQADEAEGQKDSNGDHVGTIYPDWGSNPIEVVQWRDDENLK
DFEKNIYDLGFKPGGPGF

Enzyme Prediction     

No EC number prediction in I317_03860-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	288	515	8.9e-69	0.9962121212121212

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	1.13e-27	288	515	1	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
133064	GT8_GNT1	0.009	328	417	42	132	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUB25032.1|GT71	0.0	6	738	3	686
AFR95256.2|GT71	0.0	6	738	3	686
UOH81159.1|GT71	0.0	6	738	3	686
ADV24684.1|GT71	0.0	6	738	3	679
AAW43051.2|GT71	0.0	6	738	3	700

PDB Hits     

I317_03860-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59KJ7|MNN21_CANAL	1.65e-13	219	504	186	519	Alpha-1,2-mannosyltransferase MNN21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN21 PE=3 SV=1
sp|Q59WF4|MNN2_CANAL	1.39e-09	283	509	181	459	Alpha-1,2-mannosyltransferase MNN2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN2 PE=1 SV=2
sp|Q5AD72|MNN24_CANAL	1.56e-09	287	474	291	518	Alpha-1,2-mannosyltransferase MNN24 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN24 PE=3 SV=1
sp|Q5A687|MNN22_CANAL	2.86e-08	290	513	164	434	Alpha-1,2-mannosyltransferase MNN22 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN22 PE=2 SV=1
sp|Q5AP90|MNN23_CANAL	3.85e-08	285	413	169	302	Alpha-1,2-mannosyltransferase MNN23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN23 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000024	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I317_03860-t43_1-p1.