CAZyme Information: I317_03518-t43_1-p1

Basic Information

• Species: Kwoniella heveanensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella heveanensis
• CAZyme ID: I317_03518-t43_1-p1
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410	KV700190|CGC1	43196.88	5.3433

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KheveanensisCBS569	8002	1296119	131	7871

• Gene Location: location=KV700190:116967-118620(+)

Full Sequence      

MQLSLLVPVLALLATPALSAGAPYPQGHNPHRRHLSKVADHARSVERLATAVQRREASVG
AAAAAGGLVEKKKRRVNRRGVTCRAKTSSDSAPAATASSTTAASAETTAASTLAETSVAS
DAATSPATTQAATTSVEATAISSSAAAATTTAATNGTSSNGQYTPNGIKAGIAGGDAYDV
VKDHIGWWYDWSADPSGHSGTPIAVPMLWGAGTVDSTDASRLSVFKALTSTPQYIMGFEE
PDCSTEGSANIDVSTAVGLWDSLIGPWKAKGSTLISPSMCHQAAEKYINWLGAFNQQISV
PWDITNLHINKNSMDGVKEDIDYYWNTFGKPIWVTEFACVDDSSSFIPCTDQTEINDYIN
QIVDLFESDERVHAYGYSNGLGLGDVWPMYTNGALTASGQTYLSAISKYH

Enzyme Prediction     

No EC number prediction in I317_03518-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	180	402	7.3e-53	0.9776785714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371727	Glyco_hydro_cc	4.31e-58	184	402	17	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.
236002	PRK07369	0.002	166	278	294	399	dihydroorotase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
PNP47955.1|GH128	5.81e-93	164	410	7	254
UKZ69748.1|GH128	3.02e-90	164	410	7	254
UKZ94447.1|GH128	1.71e-89	164	410	7	254
QYT06237.1|GH128	4.13e-89	164	410	23	270
UKZ58231.1|GH128	3.31e-88	164	410	23	270

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UBC_A	4.02e-131	163	410	197	444	Chain A, Glyco_hydro_cc domain-containing protein [Cryptococcus neoformans]
6UBD_A	4.47e-94	164	410	29	276	Chain A, Glyco_hydro_cc domain-containing protein [Trichoderma gamsii]
6UAX_A	2.68e-17	165	405	91	345	Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56],6UAX_B Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56]
6UAQ_A	9.73e-15	164	405	24	262	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei],6UAR_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose [Amycolatopsis mediterranei]
6UFL_A	2.42e-14	164	405	24	262	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) in the complex with laminarihexaose [Amycolatopsis mediterranei],6UFZ_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09788|ASL1_SCHPO	1.29e-09	179	404	312	530	Alkali-sensitive linkage protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=asl1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000343	0.999612	CS pos: 21-22. Pr: 0.7340

TMHMM  Annotations     

There is no transmembrane helices in I317_03518-t43_1-p1.