CAZyme Information: I317_02752-t43_1-p1

Basic Information

• Species: Kwoniella heveanensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella heveanensis
• CAZyme ID: I317_02752-t43_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
520		58974.52	5.6666

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KheveanensisCBS569	8002	1296119	131	7871

• Gene Location: location=KV700182:183210-185221(-)

Full Sequence      

MVRTQEQLAKSKSLEIRVHPEGRYLVSGPKDEPFFWQADTAWEIFHRLDEQEVKLYLDKR
AAQGFNVIFGVLFAEHGGVTLPNRQGEWPFHPKDPSASEYYPDVFRPNEKYFDYVDFIID
YAASVGIRVAIQPVWGNYVAGVYHRIEHYFDNVDAARAFGKFSGARYPFLPYLNGGDVHR
YWFDDAAFNARVGKPTRAPHVKIIDYGPVFEAFAQGIIEGEATHRPNGSQPFIAFHPTAS
WLPDTPQPYASHLFPDSKWLTIDGIQSGHSADREYPHLEDPSIGTLHWFKAQNSVDYVRE
MYATSTRDGSLRPVIDLEAHYESTHYEFRPEKDQWKASNIRQGAWQAVFAGAAGITYGVN
SIWQMNNLNSKSHPPIPHNTVSAANWFDELDLPGATYVGIATRWFLSRPTYFSRIPDQSV
ITSDTFDRPTPEDDYDGKDAKLISATRDKNDAWLAVYTPEGADFEVDLSSLQGDKLTASW
FNPRTGEEKSAGPVEKGQVKVVTPSKGKDNHDWVYYVSVA

Enzyme Prediction     

No EC number prediction in I317_02752-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	16	514	9.8e-88	0.9902912621359223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404153	DUF4038	1.46e-88	22	408	2	320	Protein of unknown function (DUF4038). A family of putative cellulases.
403955	Collagen_bind_2	1.79e-23	415	514	1	88	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KNX49908.1|GH140	0.0	1	520	1	520
KAE8156220.1|GH140	3.82e-97	33	520	45	510
KAE8313632.1|GH140	7.59e-97	22	514	35	504
KAB8203844.1|GH140	4.21e-96	33	514	45	504
KAB8276359.1|GH140	5.94e-96	25	514	37	504

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	3.18e-38	3	517	5	444	Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	4.02e-37	3	517	5	444	Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

I317_02752-t43_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000075	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I317_02752-t43_1-p1.