CAZyme Information: I317_02450-t43_1-p1

Basic Information

• Species: Kwoniella heveanensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella heveanensis
• CAZyme ID: I317_02450-t43_1-p1
• CAZy Family: GH152
• CAZyme Description: dolichyl-diphosphooligosaccharide-protein glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
828		91767.19	8.2546

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KheveanensisCBS569	8002	1296119	131	7871

• Gene Location: location=KV700179:100340-103549(+)

Full Sequence      

MPPKAAKSPAPASAATPAQTQPTALPRKASADLLSTTASQQATDNGIEDAPAAATKSRKL
AYPLPAGISPTTINNTQSLLRFIILALICGAAIGSRLFAVIRFESVIHEFDPWFNFRASK
VLVNEGFYEFWNWFDPTAWYPLGRTVGTTLYPGLMVTSGLIWHALRLINMPVDIRNVCVL
LAPGFAGLTAWATYLFTTEMSTPSAGLLAAAFIGIAPGYISRSVAGSYDNEAIAIFLLMS
SFYFWIKALKTGSSLWGMVTALFYGWMVAAWGGYVFITNMIPLHAFVLILMGRFNNRLYT
AYSSWYVIGTIASMQVPFVEFLPIRTSEHMAALGVFGLLQLIAFVETVRRLVPGKQFQLL
LRAFVVAVFIVSFAALVVLTFSGWIAPFAGRFYSLWDTGYAKVHMPIIASVSEHQPTAWP
SFFFDLEMLIFFFPAGVFWCFKELRDEQVFIIIYATLSAYFAGVMVRLMLVITPVVCVSA
AIAFSKLLEAYIDPVVPESEDEIEEATSSQPMSKAKAKKIAAAAAQKDKVEFSFTGILGG
GKGTKGIFGLDTRFAVVSILSLFLFLFVFHCTWVTSTAYSSPSVVLASRNPDGSQNIIDD
FREAYYWIRQNTEKDAVVMSWWDYGYQIAGMADRPTLVDNNTWNNTHIATVGKAMSSNED
VAYPILRKHDVDYVLVIFGGLLGYSGDDINKFLWMVRIAQGIWPDEVQEINYFTQRGEYA
VDDRATPTMKNSLMYKMSYYRFHELFGGHPAQDRVRGQQIPATGIQLDTLDEAFTSENWI
VRIYKVKKEDPIGREHKAVTAWEGGKKLRKSASSTVAAGGGNKGRPSM

Enzyme Prediction     

EC	2.4.99.18:21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	81	744	1.5e-190	0.84992784992785

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396873	STT3	6.98e-135	79	496	1	421	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
224206	Stt3	4.06e-104	79	823	18	763	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].
275016	archaeo_STT3	8.62e-23	109	676	32	586	oligosaccharyl transferase, archaeosortase A system-associated. Members of this protein family occur, one to three members per genome, in the same species of Euryarchaeota as contain the predicted protein-sorting enzyme archaeosortase (TIGR04125) and its cognate protein-sorting signal PGF-CTERM (TIGR04126).
404170	PMT_2	0.003	174	268	24	112	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
227621	COG5305	0.010	93	409	30	353	Uncharacterized membrane protein [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB76874.2|GT66	0.0	58	828	53	818
AUB27077.1|GT66	0.0	57	828	55	821
AFR97095.2|GT66	0.0	57	828	55	821
AAW45538.2|GT66	0.0	65	828	63	821
UOH83418.1|GT66	0.0	57	828	55	821

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6C26_A	2.21e-305	77	794	13	690	The Cryo-EM structure of a eukaryotic oligosaccharyl transferase complex [Saccharomyces cerevisiae S288C],6EZN_F Cryo-EM structure of the yeast oligosaccharyltransferase (OST) complex [Saccharomyces cerevisiae S288C],7OCI_F Chain F, Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 [Saccharomyces cerevisiae S288C]
6S7T_A	8.00e-288	63	790	53	776	Cryo-EM structure of human oligosaccharyltransferase complex OST-B [Homo sapiens]
6FTG_5	9.69e-253	67	793	5	701	Subtomogram average of OST-containing ribosome-translocon complexes from canine rough microsomal membranes [Canis lupus familiaris],6FTI_5 Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Programmed 80S Ribosome [Canis lupus familiaris]
6S7O_A	1.94e-252	67	793	5	701	Cryo-EM structure of human oligosaccharyltransferase complex OST-A [Homo sapiens]
6FTJ_5	2.85e-252	67	787	5	695	Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Non-programmed 80S Ribosome [Canis lupus familiaris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94335|STT3_SCHPO	1.54e-313	80	814	24	745	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit stt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=stt3 PE=3 SV=1
sp|P39007|STT3_YEAST	1.14e-304	77	794	13	690	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STT3 PE=1 SV=2
sp|Q8TCJ2|STT3B_HUMAN	4.11e-287	63	790	53	776	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1
sp|E2RG47|STT3B_CANLF	1.17e-286	63	790	53	776	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Canis lupus familiaris OX=9615 GN=STT3B PE=1 SV=1
sp|Q3TDQ1|STT3B_MOUSE	6.02e-286	65	790	52	773	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Mus musculus OX=10090 GN=Stt3b PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000002

TMHMM  Annotations     

Start	End
78	100
140	162
174	196
206	225
232	249
269	291
298	320
330	352
364	386
449	471
554	576