CAZyme Information: I317_02049-t43_1-p1

Basic Information

• Species: Kwoniella heveanensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella heveanensis
• CAZyme ID: I317_02049-t43_1-p1
• CAZy Family: GH13
• CAZyme Description: MIPC synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
675	KV700175|CGC1	75510.36	5.5087

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KheveanensisCBS569	8002	1296119	131	7871

• Gene Location: location=KV700175:139554-141859(-)

Full Sequence      

MSFNIRSTSSSSSRRQHHDDRPKSTRTRKIVITLLVLLSLVLIGTVVVLSSVSYYLGIPS
WAYLTESEVSWRPEDVIKQLQDPASSLPSRRTVQRRQDWAEVSEAQVESATAAVEGIMGT
DALPESWKELEQEMEELDAAEESEELPSYDDSVEVVTSGDAVASTSEESDIWGIDGQGSG
GYWMQKDWDGRVQGTDSWERLYNVTTRPGETIPRLIHQTWKSDQLPEKWQKAWKECREGM
PDYEYMLWTDETSRDFIAKHYPAHLHMFETYKYPIQRADSIRYFILHHFGGVYMDLDIGC
RRRLDPLLQGDWEVILPITKPVGVSNDLIFSSKGSAFMDDTIHGLSTFNHQYFTNYPTVM
FSTGPMFLSAQYALYSSAHPLTETHPRAEVRILPKSLYGKNAPMSSVPHSFFSHFYGSSW
HSDDAGFITFLGVWGKGLMWVGLVVIVLGAIRLIWVKRKSATAQQYQLLSILPTTSTHGT
IGHRSGASSPTSSSGSNGPMSPSSTYEMGTLPHQLPSDIASVFKRAGNLILAAPATLLSG
DRERDRRGRKKTGLLYFVPALFQPGPVPRSRGRTASEASQLPLRRPRKNRVPPPPYEQIT
SSSKDNEIPRSRSPAKMGGTEADSTMDEVDAFLHEADTEGESSNYADAEAEADADGDDQS
EREWAAWDGKANERT

Enzyme Prediction     

No EC number prediction in I317_02049-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	228	309	3.2e-21	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	8.01e-45	210	428	80	288	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.36e-23	226	308	1	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB76679.2|GT32	1.19e-277	24	640	14	632
ADV23773.1|GT32	2.01e-276	28	640	68	682
UOH84801.1|GT32	7.27e-263	24	639	14	626
AUB28991.1|GT32	1.55e-259	29	639	68	675
AFR98795.2|GT32	1.55e-259	29	639	68	675

PDB Hits     

I317_02049-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14084|IMT1_SCHPO	1.08e-59	205	425	55	266	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q10323|IMT3_SCHPO	5.94e-56	201	431	44	265	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P33300|SUR1_YEAST	5.56e-51	210	425	53	256	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	1.27e-50	208	431	58	270	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	2.75e-48	199	428	71	289	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000003	0.000026

TMHMM  Annotations     

Start	End
30	52
437	456