CAZyme Information: I317_02026-t43_1-p1

Basic Information

• Species: Kwoniella heveanensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella heveanensis
• CAZyme ID: I317_02026-t43_1-p1
• CAZy Family: GH128
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
867		95036.47	5.7806

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KheveanensisCBS569	8002	1296119	131	7871

• Gene Location: location=KV700175:63375-66615(+)

Full Sequence      

MPAPNEANHKMDRSFLSAKIPDLLKSLTTDEKISLLAGQDFWNTVPVPRLNIPSIKVSDG
PNGARGGSFYHMTPATALPAATALGATFSTPLIRSAGELLAAETKARNAVCLLAPTINIQ
RSPLGGRAFESFSEDPTLSGLIAAAYINGLQSEGVSAAIKHFVGNDQEHERNGEDSIIAP
RPLREVYLRPFQLAQKHSGPQAYMTSYNKVNGTHSSENKWLIDDLLRNEWGFKGLVMSDW
FGTYSVSESINAGLNLEMPGPTVWRTTQLVNHLLKAHKIDPRQLDKVVTGVLEWVQMLAK
KNEDIVYAAPSPEKTRYDDKEADAKLLRRLGAEGIVLLKNEREILPLKGRKKVAVIGPNA
KAKVITGGGSAALRAAWSSSPWTGLQENAPEGLELSYSTGCEGTKFLPLLNEDFTCEDGS
KGFDLRHYPVEDSGEMAKEATVVEKWDTSDLFMADFTDPSLGKAFCTEVRATFTAPVDGE
YEFGLVVTGKGWVWVDEELIIDNSKKQTRGDAFFGSGTIEKKGTIKVQKGKKYAIRMLHD
NRQPEDSTGPAVFAGQGVRLGAFLKTDPDVAISDAASLAAQSDVAVIVVGLNADWESEGY
DRPDLSLPLRSNELISAVAKANPNTVVVIQAGSAVSMPWIDEVKGVVYAWYLGNECGNAI
ADVVYGHRNPSGRLPITLPKRELDIAANLNYKSARTKIHYEEGIWVGYKHFNARGIEPLF
PFGHGLSYTEFEYSDLKIVEKPSEAKAEGGDSDSWKVDVSVQVKNVGKVAGDHSVHFYTC
PPAETATGLKHPQWTLQAFEKVYDLQPGAAKTVTVTLDKYAVSHWDELWNTWRAEQGEWT
VRVGKDAQTMVGEAKFVIDRELEWRGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	47	259	4e-64	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.84e-68	18	856	36	762	beta-glucosidase BglX.
224389	BglX	3.19e-61	39	371	47	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	3.52e-53	335	728	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	4.58e-34	16	818	49	743	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	6.55e-33	85	293	95	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB76680.1|GH3	0.0	8	867	5	863
ADV23736.1|GH3	0.0	8	867	5	863
UOH84802.1|GH3	0.0	8	867	5	863
AAW44922.2|GH3	0.0	8	867	5	863
AGV14847.1|GH3	0.0	8	867	5	863

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	9.92e-212	20	867	6	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	6.28e-207	20	867	6	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	8.29e-135	16	851	1	661	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
4I3G_A	1.67e-103	17	854	51	824	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]
5WAB_A	7.90e-102	24	859	9	664	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WU49|BGLI_ASPFU	2.88e-234	24	867	10	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	2.88e-234	24	867	10	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	1.15e-233	24	867	10	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	9.23e-233	24	867	10	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	3.82e-232	24	867	10	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I317_02026-t43_1-p1.