CAZyme Information: I317_01704-t43_1-p1

Basic Information

• Species: Kwoniella heveanensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella heveanensis
• CAZyme ID: I317_01704-t43_1-p1
• CAZy Family: GH128
• CAZyme Description: 1,3-beta-glucanosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
556	KV700171|CGC2	57727.38	4.0337

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KheveanensisCBS569	8002	1296119	131	7871

• Gene Location: location=KV700171:174687-177412(-)

Full Sequence      

MRFPSLALLGVSLFSLTANALPKITRTGKYLYDESGSRFYIKGVAYQPQGELAESSDANT
ANGGFPEPSSFHDPLSSPQNCTRDLPYLKQLGVNSIRVYSVNSSLNHDECMKTFSDAGIY
LLLDVSLPLNGSIDRSSPSWSTNLLNEYISTIDAFRNYDNVLGFNIGNEVITTVGNTNAA
PYVKAAARDVKAYLKSVNSNALVGYSATDGDADFRNSLAEYMTCGAEDLTVDLYGLNNYE
WCGDENLNSSNWNTITQGFSGIPVATYMSEFGCIFRPPRLWTEVAALFSSPVSDVFSGGM
AFSYFPTSDGYGMVTISSDGNTITTSDDFTRLSTQYNATTPPNSPSKGSVQAGTTECPSE
SASLIASTTLPPTPNEAVCNCINEKSLACQLNQASANSPTIVGDLLNYACSLLGSGTNGT
ASCDPIGGNGTSGEYGELSYAMSAYYEFNPIDSSCDFSGNATLSPNRPNTASDASSAAQQ
CLSSEPSGGVFTPTASSSGASNTGTASGSSTSPASSSGSSSGGSNNSGALPSLNIGAGAG
ALGLMGAVVGGLMVAL

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	18	338	5.5e-110	0.9903846153846154

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	5.85e-116	13	339	1	314	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.
400371	X8	6.82e-14	402	462	14	76	X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains.
197867	X8	3.90e-10	398	472	10	82	Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges.
225344	BglC	3.30e-04	84	204	78	225	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW47197.1|CBM43|GH72	7.37e-286	1	551	1	559
AUB28916.1|CBM43|GH72	3.60e-284	1	551	2	560
AFR98731.2|CBM43|GH72	3.60e-284	1	551	2	560
UOH85570.1|CBM43|GH72	2.00e-283	1	551	1	559
ADV25841.1|CBM43|GH72	9.07e-282	1	501	1	507

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W62_A	7.62e-83	22	439	34	440	Saccharomyces cerevisiae Gas2p in complex with laminaripentaose [Saccharomyces cerevisiae],2W63_A Saccharomyces Cerevisiae Gas2p In Complex With Laminaritriose And Laminaritetraose [Saccharomyces cerevisiae],5O9O_A Crystal structure of ScGas2 in complex with compound 7. [Saccharomyces cerevisiae S288C],5O9P_A Crystal structure of Gas2 in complex with compound 10 [Saccharomyces cerevisiae S288C],5O9Q_A Crystal structure of ScGas2 in complex with compound 6 [Saccharomyces cerevisiae S288C],5O9R_A Crystal structure of ScGas2 in complex with compound 9 [Saccharomyces cerevisiae S288C],5O9Y_A Crystal structure of ScGas2 in complex with compound 11 [Saccharomyces cerevisiae S288C],5OA2_A Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_B Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_C Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA6_A Crystal structure of ScGas2 in complex with compound 12 [Saccharomyces cerevisiae S288C]
2W61_A	2.10e-82	22	439	34	440	Saccharomyces cerevisiae Gas2p apostructure (E176Q mutant) [Saccharomyces cerevisiae]
5FIH_A	2.10e-82	22	439	34	440	SACCHAROMYCES CEREVISIAE GAS2P (E176Q MUTANT) IN COMPLEX WITH LAMINARITETRAOSE AND LAMINARIPENTAOSE [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9P378|GAS1_SCHPO	3.98e-106	1	463	1	447	1,3-beta-glucanosyltransferase gas1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gas1 PE=1 SV=1
sp|P0C956|GEL4_ASPFU	4.73e-106	29	461	45	467	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel4 PE=3 SV=1
sp|B0XVI5|GEL4_ASPFC	4.73e-106	29	461	45	467	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel4 PE=1 SV=1
sp|P22146|GAS1_YEAST	1.33e-101	17	463	21	453	1,3-beta-glucanosyltransferase GAS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAS1 PE=1 SV=2
sp|P56092|EPD1_CANMA	1.42e-101	3	488	7	472	Protein EPD1 OS=Candida maltosa OX=5479 GN=EPD1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000233	0.999718	CS pos: 20-21. Pr: 0.9771

TMHMM  Annotations     

There is no transmembrane helices in I317_01704-t43_1-p1.