CAZyme Information: I317_01166-t43_1-p1

Basic Information

• Species: Kwoniella heveanensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella heveanensis
• CAZyme ID: I317_01166-t43_1-p1
• CAZy Family: CE4
• CAZyme Description: starch phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
926	KV700166|CGC1	104763.64	6.1134

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KheveanensisCBS569	8002	1296119	131	7871

• Gene Location: location=KV700166:44183-47856(+)

Full Sequence      

MVYTGPGDAPLSRSRSRSSSHGSRTPNLHQPNLSRRSSLSAGHPHSLKQIDTSQIGVPIV
TPRKERPGHVRSLTGSYFPAQKGVVSMEDEWPIGDETTWKKALKAMEFDHEDEQEVANTV
VRHVTTSLARQAYNIDTVAAYQATALSVRDRLLERWNETALHHTKKAPKRIYYFSIEWLI
GRSLDNAVLNLGMRNTYESSTQKLGFNFEDLLNEERDAGLGNGGLGRLAACYIDSMATLN
IPGWGYGLRYNYGIFKQLISSTGEQLEAPDPWLDRENPWEIGRLDVAYPIRFYGRVESVP
NSDKAVWSGGMECLAVAYDTPIPGFNTKNCANIRLWSAKPVQGFDLNSFNAGNYEASVAA
SSEVQNITRVLYPNDNMYAGKKLRIMQQYLWVSASLQDILRRFTKLDLPWTDLPDYVCIQ
MNDTHPTLAIPELMRILIDEEELDYNTAWGITTKVFAYTNHTVLPEALERWQIDLFESLL
PRHLQIIYRINYDFMQAVAKRWPGDMDRMRRMSIIEEGTPKYVRMAYLAIVGSFKVNGVA
ELHSQLLQSTIFRDFVEFKGRDFFTNVTNGITPRRWLLQCNPQLAALITHTIGNDHWLTH
LKTLKNLLPMSENEEFRKAFTSIKLENKQRLADLVESELGITLDIDSLFLTQIKRLHEYK
RQTLNLFGVIYRYLRIKQASPEDRKKFTKHTAIFAGKAAPGYYVAKLVIRLINNVARVVN
NDPDVGNLLKVVFIPDYSVSIAEVLVPASDVSVQISTAGTEASGTSNMKLALNGALLLGT
VDGANVEIAEDAGEDQSFLFGHLAEQVEGVRFTNSYQPTPLEQRSPELAQVFKAIESGTF
GEGNTYESLLKTVYEHDYYLVSNDFGSYLQAEKLMDECYLNNRTEWTKKSILTAFNMGDF
SSDRSVQDYADGIWSVEPCEVPNPDN

Enzyme Prediction     

EC	2.4.1.1:158

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	202	917	3.8e-267	0.9955489614243324

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223136	GlgP	0.0	108	918	1	750	Glucan phosphorylase [Carbohydrate transport and metabolism].
237881	PRK14985	0.0	152	914	42	794	maltodextrin phosphorylase; Provisional
273967	P_ylase	0.0	120	916	1	794	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
340853	GT35_Glycogen_Phosphorylase	0.0	117	916	1	795	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
395272	Phosphorylase	0.0	202	916	2	661	Carbohydrate phosphorylase. The members of this family catalyze the formation of glucose 1-phosphate from one of the following polyglucoses; glycogen, starch, glucan or maltodextrin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW44124.1|GT35	0.0	18	922	18	923
AUB25813.1|GT35	0.0	19	922	18	922
AFR95951.2|GT35	0.0	19	922	18	922
KGB76066.3|GT35	0.0	18	922	17	922
ADV22853.1|GT35	0.0	18	922	17	922

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1YGP_A	3.50e-305	67	918	1	877	Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site. [Saccharomyces cerevisiae],1YGP_B Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site. [Saccharomyces cerevisiae]
5IKO_A	2.37e-257	112	924	27	839	Crystal structure of human brain glycogen phosphorylase [Homo sapiens],5IKP_A Crystal structure of human brain glycogen phosphorylase bound to AMP [Homo sapiens]
4BQE_A	6.82e-256	111	922	58	874	Arabidopsis thaliana Cytosolic Alpha-1,4-glucan Phosphorylase (PHS2) [Arabidopsis thaliana],4BQE_B Arabidopsis thaliana Cytosolic Alpha-1,4-glucan Phosphorylase (PHS2) [Arabidopsis thaliana],4BQF_A Arabidopsis thaliana cytosolic alpha-1,4-glucan phosphorylase (PHS2) in complex with acarbose [Arabidopsis thaliana],4BQF_B Arabidopsis thaliana cytosolic alpha-1,4-glucan phosphorylase (PHS2) in complex with acarbose [Arabidopsis thaliana],4BQI_A ARABIDOPSIS THALIANA cytosolic alpha-1,4-glucan phosphorylase (PHS2) in complex with maltotriose [Arabidopsis thaliana],4BQI_B ARABIDOPSIS THALIANA cytosolic alpha-1,4-glucan phosphorylase (PHS2) in complex with maltotriose [Arabidopsis thaliana]
1Z8D_A	1.33e-255	111	925	23	839	Chain A, Glycogen phosphorylase, muscle form [Homo sapiens]
1C8L_A	7.55e-255	111	925	22	838	Synergistic Inhibition Of Glycogen Phosphorylase A By A Potential Antidiabetic Drug And Caffeine [Oryctolagus cuniculus],1LWN_A Crystal structure of rabbit muscle glycogen phosphorylase a in complex with a potential hypoglycaemic drug at 2.0 A resolution [Oryctolagus cuniculus],1LWO_A Crystal structure of rabbit muscle glycogen phosphorylase a in complex with a potential hypoglycaemic drug at 2.0 A resolution [Oryctolagus cuniculus],2GPA_A Allosteric Inhibition Of Glycogen Phosphorylase A By A Potential Antidiabetic Drug [Oryctolagus cuniculus],3AMV_A Allosteric Inhibition Of Glycogen Phosphorylase A By A Potential Antidiabetic Drug [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P06738|PHSG_YEAST	6.11e-306	67	918	24	900	Glycogen phosphorylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPH1 PE=1 SV=4
sp|Q00766|PHS1_DICDI	3.12e-301	102	921	31	845	Glycogen phosphorylase 1 OS=Dictyostelium discoideum OX=44689 GN=glpV PE=1 SV=3
sp|P34114|PHS2_DICDI	6.37e-284	111	924	109	915	Glycogen phosphorylase 2 OS=Dictyostelium discoideum OX=44689 GN=glpD PE=1 SV=2
sp|P32811|PHSH_SOLTU	4.49e-260	111	922	21	838	Alpha-glucan phosphorylase, H isozyme OS=Solanum tuberosum OX=4113 PE=1 SV=1
sp|Q9XTL9|PYG_DROME	2.20e-259	115	926	27	840	Glycogen phosphorylase OS=Drosophila melanogaster OX=7227 GN=GlyP PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I317_01166-t43_1-p1.