CAZyme Information: I317_01110-t43_1-p1

Basic Information

• Species: Kwoniella heveanensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella heveanensis
• CAZyme ID: I317_01110-t43_1-p1
• CAZy Family: CE4
• CAZyme Description: cytoplasmic protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
849		94625.40	5.5882

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KheveanensisCBS569	8002	1296119	131	7871

• Gene Location: location=KV700165:249273-252100(-)

Full Sequence      

MPPPPTRSPVTGNPVPPYYIHSDTINFRDVHGRSLLLRGVNLSGSAKNPNGQPSHVRENF
WEAAEAGKGDFMNRPLNLDDGSADVHLARLRAWGYNMLRYVFTWESIEHEGPKKYDYEYM
DYIIRVLKKCKEWGFRVFMDPHQDVWSRFTGGSGAPLWTIYACGIDPYGLTPTAAAYIHC
EWPNAESPKPETFPAMIWGTNYSRLACQTIWTLFFAGKTYAPKCIIDGKNIQDYLQEHFI
DAVGTLAKKIADEAPDLLDECVIGWDSVNEPGEGLIGQHDLSRIPDEQQLKKGPSPTPIE
GMRLGMGQPQEVQIWNFGALGPYRGGHQKIDPKGKKVWLTKEEDVQRGSGKWGWTRGEEW
ELGMCIWAQHGVWDPATGELLRPDHFTTLPTDPTHEVDFVADFWSLHWLAYSSRVRLHHP
ESIHFIQAPVLKQPPKLPRSFLKDRACSSPHFYDGLTLMTKHWNWFNADAIGVIRKKYWS
IVQAVRVGEGNIRNMIQGELGVLKQDTVDILGTYPTLIGEIGVPYDMDGKKAYGYVDGGR
GEGDYSLQQRAMDCSMNACDGPNCLNYTIWTYVPDHCHEWGENWNGEDLSLWSADDIPRD
SLSVNYKSSDPNSPVIGHSAGLNTNATSSSATLTVSRPQTPKVPLSPASIDAGDITPSLL
LDGSRAIAAFCRPFPMATVGAPERMDFDIATSTFKLSVRVKSNDVSSKQVATEIYVPYVH
YAATLGKSSSDTNDPSSSTLPSRNSSRTDLLTAEEAETKKDRIGADVRSVATSTSAIPNL
ELDIDIKTSHGRTEIQGQKVIWYYDTPDQEVEATYTIEIKRTGGALARDMGYVQEGSWFD
VCPSSCVIA

Enzyme Prediction     

EC	3.2.1.21:3	3.2.1.45:1	3.2.1.104:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	29	578	1.7e-212	0.9981447124304267

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408348	Glyco_hydro_5_C	7.29e-10	672	721	1	48	Glycoside hydrolase family 5 C-terminal domain. This is the C-terminal domain of endo-glycoceramidase II (EGC), a membrane-associated family 5 glycosidase pfam00150. The C-terminal domain assumes a beta-sandwich fold, which resembles that of many carbohydrate-binding modules.
395098	Cellulase	5.95e-04	87	144	30	88	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW45117.1|GH5_12	0.0	1	849	1	851
AFR99035.1|GH5_12|3.2.1.104	0.0	1	849	1	851
AUB29264.1|GH5_12	0.0	1	849	1	851
UOH85036.1|GH5_12	0.0	1	849	1	851
KGB78428.2|GH5_12	0.0	1	849	1	851

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LPO_A	0.0	1	849	2	797	Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_A Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_A Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99]
2OSW_A	8.19e-10	28	276	38	230	Endo-glycoceramidase II from Rhodococcus sp. [Rhodococcus sp.],2OSW_B Endo-glycoceramidase II from Rhodococcus sp. [Rhodococcus sp.],2OYK_A Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like isofagomine complex [Rhodococcus sp.],2OYK_B Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like isofagomine complex [Rhodococcus sp.],2OYL_A Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like imidazole complex [Rhodococcus sp.],2OYL_B Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like imidazole complex [Rhodococcus sp.],2OYM_A Endo-glycoceramidase II from Rhodococcus sp.: five-membered iminocyclitol complex [Rhodococcus sp.],2OYM_B Endo-glycoceramidase II from Rhodococcus sp.: five-membered iminocyclitol complex [Rhodococcus sp.]
2OSX_A	8.19e-10	28	276	38	230	Chain A, Endoglycoceramidase II [Rhodococcus sp.]
2OSY_A	2.49e-09	28	165	38	161	Chain A, Endoglycoceramidase II [Rhodococcus sp.],2OSY_B Chain B, Endoglycoceramidase II [Rhodococcus sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|H1AE13|EGCR1_ASPFM	1.35e-191	23	724	9	689	Glucosylceramidase OS=Neosartorya fumigata OX=746128 GN=egc1 PE=1 SV=1
sp|P40566|EGH1_YEAST	2.71e-149	27	721	13	702	Ergosteryl-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EGH1 PE=1 SV=1
sp|I1BTD7|EGCR1_RHIO9	4.82e-93	27	721	22	628	Glucosylceramidase OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) OX=246409 GN=ERC1 PE=1 SV=1
sp|H1AE12|EGCR1_CRYNH	7.44e-66	26	717	22	635	Glucosylceramidase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=EGC1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I317_01110-t43_1-p1.