CAZyme Information: I317_01047-t43_1-p1

Basic Information

• Species: Kwoniella heveanensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella heveanensis
• CAZyme ID: I317_01047-t43_1-p1
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
559		57760.35	8.4416

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KheveanensisCBS569	8002	1296119	131	7871

• Gene Location: location=KV700165:37557-40405(-)

Full Sequence      

MLLNTLLPLLGLLSLSMAAPLVRPKRALPRLGGVNLAGCDFGMNTDGWSGTTYCPGTEQI
AHFANKGANIFRLPVGWQYLVGSTTDSSSKALDATYFAKYDNLVQTSLATGAYVMIDLHN
YARWNGQIVGQGGPSDANLANLWSLVAKKYANQPKIIFGIMNEPHDVDVSVWATTVQASV
NAIRAAGAITQSIALPGYEWTHPEAWSRGSNDPLLNVKDPVDASGSLLIIDAHKYYDSDG
SGTNAECTTNGVQVFTEFRTWLQKVGRKAVISETGGGNTASCQTAVGEAIKYISSNTDVF
IGFTIWSAGSFDSSYVLSITPNGDTDNQLFVKAVQPYLPGSSGSTPAPASSSKAVSTVVS
SSSMSQAASSSATSTKASTTSSTGRSTSSPAGSSSAVRTSTTAKPSTTASSVTSTVRSST
TAKSTTLASTSAKPTTSTSAKTSSTTSAAAVPPATTSAVTGSGGLQTFKGALGGIAAPAV
TASGNQYTTSGRTFNFLVDALNASCYAQMDKCQSAANSSGNKGDLTVNNCNGQVQECLKK
ASSTFRLIDTWMLAGLETP

Enzyme Prediction     

EC	3.2.1.4:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	32	315	1.8e-92	0.9893617021276596

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	3.62e-58	34	309	1	272	Cellulase (glycosyl hydrolase family 5).
225344	BglC	1.16e-18	33	313	54	364	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APB92618.1|GH5_5	4.30e-131	5	339	5	340
ABP02069.1|GH5_5|3.2.1.4	9.80e-130	5	339	5	340
AAC60541.1|GH5_5|3.2.1.4	6.55e-128	5	339	5	341
BAA03070.1|GH5_5|3.2.1.4	6.55e-128	5	339	5	341
AEO69910.1|CBM1|GH5_5	3.64e-98	30	329	92	409

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QR3_A	4.40e-97	30	329	4	320	Chain A, Endoglucanase EG-II [Trichoderma reesei],3QR3_B Chain B, Endoglucanase EG-II [Trichoderma reesei]
5D8W_A	3.04e-86	30	321	23	324	Structrue of a lucidum protein [Ganoderma lucidum],5D8W_B Structrue of a lucidum protein [Ganoderma lucidum],5D8Z_A Structrue of a lucidum protein [Ganoderma lucidum],5D8Z_B Structrue of a lucidum protein [Ganoderma lucidum]
1GZJ_A	3.29e-50	33	338	7	304	Structure of Thermoascus aurantiacus family 5 endoglucanase [Thermoascus aurantiacus],1GZJ_B Structure of Thermoascus aurantiacus family 5 endoglucanase [Thermoascus aurantiacus]
1H1N_A	6.56e-50	33	338	8	305	Atomic resolution structure of the major endoglucanase from Thermoascus aurantiacus [Thermoascus aurantiacus],1H1N_B Atomic resolution structure of the major endoglucanase from Thermoascus aurantiacus [Thermoascus aurantiacus]
5I77_A	6.23e-48	33	338	6	302	Crystal structure of a beta-1,4-endoglucanase from Aspergillus niger [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q04469|GUN1_SAIFL	1.16e-128	5	339	5	341	Endoglucanase 1 OS=Saitozyma flava OX=5416 GN=CMC1 PE=2 SV=1
sp|Q66NB7|EG5A_PHACH	3.48e-96	24	339	71	386	Manganese dependent endoglucanase Eg5A OS=Phanerodontia chrysosporium OX=2822231 GN=Eg5A PE=1 SV=2
sp|A0A024SH20|GUN2_HYPJR	1.32e-95	30	329	94	410	Endoglucanase EG-II OS=Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) OX=1344414 GN=egl2 PE=1 SV=1
sp|P07982|GUN2_HYPJE	2.62e-95	30	329	94	410	Endoglucanase EG-II OS=Hypocrea jecorina OX=51453 GN=egl2 PE=1 SV=1
sp|Q5BDU5|EGLA_EMENI	3.04e-49	11	341	3	325	Endo-beta-1,4-glucanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=eglA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000301	0.999668	CS pos: 26-27. Pr: 0.7778

TMHMM  Annotations     

There is no transmembrane helices in I317_01047-t43_1-p1.