CAZyme Information: I317_00129-t43_1-p1

Basic Information

• Species: Kwoniella heveanensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella heveanensis
• CAZyme ID: I317_00129-t43_1-p1
• CAZy Family: PL14
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
833		87039.78	3.5790

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KheveanensisCBS569	8002	1296119	131	7871

• Gene Location: location=KI669518:435751-439087(+)

Full Sequence      

MARSTIALIALYTVLTTTVYTENRVVAAAAAGPHRGGALNAAAAHRRHHARAAAAASAAG
VIHFSERDELEGFEQNGSDAEEKRDGGVCDLGAWKCVGTELQRCYNDQWNFVTNCTGINI
VCSDALYTTGCVWTWNVQDTDSSSSTSTDSESATVTASGPLETSSGSATDYLNSTASATA
DVTSSETLVANVTASPTNINLIASPSATTVTTATATTSASTSDEDDEECEDDEQDDNNDD
GEDQEDYEDDDDDEDLPYCDEIDGDDSYSTSPASSYATPVVTTTQAASTAVPTSTIGGQL
WAGGNGSSDDDTSDGSSNSDSGAGDNDSDGGDTDSADEDEDDEECDEVDESEISVTVTAT
ATAGSASSSASTSVIGGQLWAGDNGDDEEDEGSWDSASATATATATSSSSSAHGWGGQHG
WGNGHYGWDQSSTSIAATTTSDWDAEQTTSSSTLNDGQWTPSTSDASATAIDSAGSEVNT
TDSAFGSGSAGWGDESYTASSTSSSTGRHGNKWDSETFTATATATISSTLTGSAAVSTST
SKTSGNETTSSPLGSYSAPHYVVYADNWLYNMPSVSDLSSYNRFILAFWMSNQGAVDNAQ
FWEWLDASTRAQVIEEYHEAGIALMVSAFGSTDSPTSDGADPTETAQKLAEWVKEYGLDG
VDIDYEDMSAMNSAKAVSWLVVFQTELRRLLPSPYIITHAPVAPWFTSANDYSDGAYVAI
HQQVGDGIDFYNVQFYNQGDGVYGDCDTLLNDSGNDWPSTSVFEINSYAGVPLNKVVIGK
PLDEGAASNGFIDPSVLNTCVTEAQAKGWNAGVMFWEWTSSAPSIMATVRGTQ

Enzyme Prediction     

No EC number prediction in I317_00129-t43_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119349	GH18_chitinase-like	3.42e-29	561	737	1	177	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
119350	GH18_chitinase_D-like	3.20e-16	653	816	106	293	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
119363	GH18_CTS3_chitinase	3.47e-16	628	818	83	253	GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii. CTS3 has a chitinase-like glycosyl hydrolase family 18 (GH18) domain; and has homologs in bacteria as well as fungi.
226000	Chi1	4.32e-12	606	816	84	302	Chitinase [Carbohydrate transport and metabolism].
119356	GH18_hevamine_XipI_class_III	1.84e-10	658	817	122	264	This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW43533.1|GH18	7.02e-138	553	831	304	582
KGB77976.2|GH18	2.31e-136	534	831	330	627
AFR95478.1|GH18	5.39e-132	553	831	356	634
AUB25287.1|GH18	5.39e-132	553	831	356	634
ADV22450.1|GH18	2.68e-131	533	831	250	550

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K7Z_A	2.21e-18	612	820	60	264	Crystal structure of a GH18 chitinase from Pseudoalteromonas aurantia [Pseudoalteromonas aurantia],6K7Z_B Crystal structure of a GH18 chitinase from Pseudoalteromonas aurantia [Pseudoalteromonas aurantia],6K7Z_C Crystal structure of a GH18 chitinase from Pseudoalteromonas aurantia [Pseudoalteromonas aurantia],6K7Z_D Crystal structure of a GH18 chitinase from Pseudoalteromonas aurantia [Pseudoalteromonas aurantia]
3EBV_A	1.94e-07	620	808	74	254	Crystal structure of putative Chitinase A from Streptomyces coelicolor. [Streptomyces coelicolor]
4RL3_A	1.18e-06	612	742	64	191	Crystal Structure of the Catalytic Domain of a family GH18 Chitinase from fern, Peteris ryukyuensis [Pteris ryukyuensis],4RL3_B Crystal Structure of the Catalytic Domain of a family GH18 Chitinase from fern, Peteris ryukyuensis [Pteris ryukyuensis]
2Y8V_A	9.99e-06	647	823	115	271	Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_B Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_C Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_D Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

I317_00129-t43_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001907	0.998059	CS pos: 27-28. Pr: 0.9379

TMHMM  Annotations     

There is no transmembrane helices in I317_00129-t43_1-p1.