CAZyme Information: I314_06226-t35_1-p1

Basic Information

• Species: Cryptococcus gattii VGIII
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGIII
• CAZyme ID: I314_06226-t35_1-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361		41481.58	6.6715

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiCA1873	6782	1296111	148	6634

• Gene Location: location=KN848908:198441-199739(+)

Full Sequence      

MSSTKSRIQIKTIISSPTPLLPRPLPSSPSKKRQRTRVLGTMFKLFMGLGLVIYLLWVVG
FFWERAMLPQPGDGGRESTLGSEKANVLREGGGGGMISNKPEAYVTFLSSIIDPWYLLST
RLLLYQLRHHPRTSDPARPLIVLTTPQIPAAAEDKLENEGAEIKRVELLVDGFPVPEGMG
ENHHWKDQYTKLHIFNLTTYSRLLYLDNDILLLQSLAPLWETNLPTMKNGGVAGVGERNK
LSMVENDKRTRPEEGEVKDYLNAGFMMITPDEERFNELRKVRGYKPFYMEQALLNHYFDW
KGAHPWEELDPLSVSHFPQKEDLTGGYQSLHAKMWKDDIDKEVVDHWEEIIKDMEQFWNS
R

Enzyme Prediction     

No EC number prediction in I314_06226-t35_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	111	311	9.2e-29	0.754863813229572

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	5.01e-39	102	360	1	235	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
227884	Gnt1	2.67e-16	115	335	82	336	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
132996	Glyco_transf_8	6.49e-12	189	361	84	214	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
279798	Glyco_transf_8	1.96e-09	116	298	10	204	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
133037	GT8_A4GalT_like	3.03e-09	186	311	70	205	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV25383.1|GT8	3.68e-252	3	361	2	359
KGB78587.2|GT8	2.79e-237	3	361	5	365
AAW44983.1|GT8	2.79e-202	3	360	2	361
AFR98858.1|GT8	1.80e-187	3	361	2	362
AUB29069.1|GT8	1.80e-187	3	361	2	362

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3USQ_A	3.04e-06	127	299	46	192	Structure of D159S/Y194F glycogenin mutant truncated at residue 270 [Oryctolagus cuniculus]
1ZCY_A	3.80e-06	127	299	46	192	Chain A, Glycogenin-1 [Oryctolagus cuniculus],1ZDG_A Chain A, Glycogenin-1 [Oryctolagus cuniculus]
3V90_A	4.07e-06	127	299	46	192	Structure of T82M glycogenin mutant truncated at residue 270 [Oryctolagus cuniculus],3V91_A Structure of T82M glycogenin mutant truncated at residue 270 complexed with UDP-glucose [Oryctolagus cuniculus]
1ZCV_A	5.05e-06	127	299	46	192	Chain A, Glycogenin-1 [Oryctolagus cuniculus]
1ZCT_A	5.41e-06	127	299	46	192	structure of glycogenin truncated at residue 270 in a complex with UDP [Oryctolagus cuniculus],1ZCT_B structure of glycogenin truncated at residue 270 in a complex with UDP [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O43062|YGT9_SCHPO	2.44e-13	116	338	91	348	Uncharacterized protein C4C3.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC4C3.09 PE=4 SV=1
sp|O43061|MU136_SCHPO	7.80e-13	115	361	81	366	Meiotically up-regulated gene 136 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug136 PE=1 SV=1
sp|Q09680|YA0C_SCHPO	4.73e-11	80	335	46	340	Uncharacterized protein C5H10.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC5H10.12c PE=4 SV=1
sp|Q9FFA1|GOLS5_ARATH	4.32e-08	103	353	23	293	Galactinol synthase 5 OS=Arabidopsis thaliana OX=3702 GN=GOLS5 PE=2 SV=1
sp|Q8GWB7|GUX6_ARATH	1.53e-06	103	347	32	249	Inositol phosphorylceramide glucuronosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=IPUT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999975	0.000044

TMHMM  Annotations     

Start	End
41	63