CAZyme Information: I314_06140-t35_1-p1

Basic Information

• Species: Cryptococcus gattii VGIII
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGIII
• CAZyme ID: I314_06140-t35_1-p1
• CAZy Family: GT4
• CAZyme Description: cytoplasmic protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
498		55761.20	6.7405

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiCA1873	6782	1296111	148	6634

• Gene Location: location=KN848907:413264-415042(-)

Full Sequence      

MGVFSKVKDQFTQSTPSYDFPPPTPSIPLGPRAIFRYRKQRGVNLGSWFSLEQWICPHVF
RGAKPPGQSDYDVASGNDAKRILEEHWDTWINEDDMKWIASRGFNSVRLPIAYYHLCGSL
PEVLKGTDFESFRYVFEGAWGRIERAVEMAGSYGLGVLIDLHGVAGAQNPDAHAGLSRGK
VSFWDTHANQASTSLALRFLASKFASVPYVVGLELLNEPQNNRKLQSWYTKTIEEVRKVA
PPDFPIYCSDAWDTDHYASWVGSRGDFVVLDHHLYRCFTDEDKCKTGTDHANNLRSGFRG
RFAQQCEAAKGSLVVGEWSASLDPRSFPNGMPDGEKDAQRRAFVQAQLELFESHAAGYWF
WTYKKGEGWDAGWSATNASQAEILPGWVGSRQFKGAPPSHIKDQELQNGHKSHADYWAAN
GGSPNPNMYAPGFSQGWDDALIFLSAQGSPSEMGFVHQWAVRRQAEFESQGHKLGRAAWE
WEHGFKQGVEACARCCLA

Enzyme Prediction     

No EC number prediction in I314_06140-t35_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	83	368	1.8e-122	0.9964664310954063

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	2.17e-27	32	387	10	384	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	1.32e-09	74	241	3	159	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV25348.1|GH5_50	0.0	1	498	1	498
KGB80314.1|GH5_50	0.0	1	498	1	498
AAW45154.1|GH5_50	0.0	1	498	1	498
AFR99083.1|GH5_50	0.0	1	498	1	498
AUB29314.1|GH5_50	0.0	1	498	1	498

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	1.50e-31	41	393	10	387	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	2.06e-31	41	393	10	387	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	2.26e-31	41	393	16	393	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
3O6A_A	5.72e-31	41	393	15	392	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
2PC8_A	5.81e-31	41	393	16	393	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74799|EXG3_SCHPO	5.87e-69	29	484	3	444	Glucan 1,3-beta-glucosidase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=exg3 PE=3 SV=1
sp|P38081|YBQ6_YEAST	4.81e-49	25	490	31	496	Uncharacterized glycosyl hydrolase YBR056W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YBR056W PE=1 SV=1
sp|Q96V64|EXG_BLUGR	3.11e-37	26	392	20	411	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
sp|B0XN12|EXGA_ASPFC	3.59e-37	41	393	43	411	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
sp|Q4WK60|EXGA_ASPFU	3.39e-36	41	393	43	411	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I314_06140-t35_1-p1.