CAZyme Information: I314_05378-t35_1-p1

Basic Information

• Species: Cryptococcus gattii VGIII
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGIII
• CAZyme ID: I314_05378-t35_1-p1
• CAZy Family: GT24
• CAZyme Description: glucan 1,3-beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
431	KN848903|CGC3	48590.49	4.4250

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiCA1873	6782	1296111	148	6634

• Gene Location: location=KN848903:530535-532217(-)

Full Sequence      

MRLLSPFFIVPLAVVSALPALQTVDDQKRSVNVGWPYGTNKIRGVNIGGWLVTEPFITPS
LFEATGNNDIVDEWTFCQYQDYNTAQTALKNHWDTWFTEDDFARIAAAGLNHVRIPIGFW
AYDVQGGEPYIQGQADYLDRAIGWARNHNLAVMIDLHGAPGSQNGYDNSGRRGNADWATD
NTNVERTKNVIAQLSRKYSDPQYYGVVTALALLNEPATYLNDQLLQTARQYWYGAYGAAR
YPFGNSDKSGLALVIHDGFQPLSTFDNYMVEPEFEDVLLDTHNYQVFNDEYVAWNWDQHI
SNVCNQASTYSSSPLWLVVGEWSLASTDCAKYLNGRGINARYDGSYPGSSYIGSCDDKSN
DVSKFSNEYKDFMHKFWNVQTQLYEQNGQGWIHWTWKTESAADWSYEAGLDGGWIPWDAG
SHDVSLSSLCG

Enzyme Prediction     

EC	3.2.1.58:29	3.2.1.21:6	3.2.1.75:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	91	399	3.4e-115	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	2.72e-58	36	431	12	395	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	2.64e-06	80	216	3	131	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV22545.1|GH5_9	0.0	1	431	1	431
KGB79527.1|GH5_9	0.0	1	431	1	431
CAD31110.1|GH5_9	3.96e-308	1	431	1	431
AAW43562.1|GH5_9	5.62e-308	1	431	1	431
AFR95595.1|GH5_9	4.23e-303	1	431	1	431

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3O6A_A	1.26e-102	32	416	4	384	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
2PB1_A	1.83e-102	32	416	5	385	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PC8_A	5.18e-102	32	416	5	385	Chain A, Hypothetical protein XOG1 [Candida albicans]
2PBO_A	5.18e-102	32	416	5	385	Chain A, Hypothetical protein XOG1 [Candida albicans]
4M80_A	1.00e-101	32	416	4	384	The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans at 1.85A resolution [Candida albicans SC5314],4M81_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with 1-fluoro-alpha-D-glucopyranoside (donor) and p-nitrophenyl beta-D-glucopyranoside (acceptor) at 1.86A resolution [Candida albicans SC5314],4M82_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with p-nitrophenyl-gentiobioside (product) at 1.6A resolution [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12725|EXG_YARLI	1.12e-105	33	418	28	412	Glucan 1,3-beta-glucosidase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=EXG1 PE=3 SV=2
sp|Q96V64|EXG_BLUGR	1.84e-105	3	431	1	417	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
sp|Q8NKF9|EXG_CANOL	2.57e-102	5	431	6	424	Glucan 1,3-beta-glucosidase OS=Candida oleophila OX=45573 GN=EXG1 PE=3 SV=1
sp|P29717|EXG1_CANAL	1.08e-101	32	416	43	423	Glucan 1,3-beta-glucosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=XOG1 PE=1 SV=5
sp|Q12626|EXG_PICAN	1.57e-100	12	416	25	420	Glucan 1,3-beta-glucosidase OS=Pichia angusta OX=870730 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000355	0.999614	CS pos: 17-18. Pr: 0.9429

TMHMM  Annotations     

There is no transmembrane helices in I314_05378-t35_1-p1.