CAZyme Information: I314_04964-t35_1-p1

Basic Information

• Species: Cryptococcus gattii VGIII
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGIII
• CAZyme ID: I314_04964-t35_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
453	KN848901|CGC4	52149.47	5.6340

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiCA1873	6782	1296111	148	6634

• Gene Location: location=KN848901:667225-668916(-)

Full Sequence      

MNRTDLLSAGAYRKTARTGRISSWDHSGRNEDAFTVRPGESIILADVEGPGALTHLWFVQ
GCRRVLGPGVAPYTVTNCPFMETPRALGLFDEENDSDFYRKVVLKMYWDDQEEPSVLAPL
GDFFCIGHSMPANFQSLPFTVSVRPMDDHKYGGTSAVNCYLMMPFNRRARVEVENQGENT
YIQYFYIDYELYAEPFGKDILYFHAMWKRENPTNGWAPSYMSANSREIQQPKNVDGKGNY
VILETEGAGNYLGCNHSVTHLQNVWWGEGDDIIFIDDDSWPPSLHGTGGEDYFSQGWGMQ
KNAYPFAGTIVHEDDIAQNQVSYRWHMADPIRFNKRIKVTMETGHANHLRDDWSTTAYWY
QTLPGPKLFLLPIELRIPRKATISKDDVSEPDMSKATDQQRELVKQREERFKEYLADRQI
WIDRRAESSQVRAKKNVEMAQEVRDRWLASLAK

Enzyme Prediction     

No EC number prediction in I314_04964-t35_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH172	99	361	1.8e-77	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402651	DUF2961	1.18e-99	100	361	1	234	Protein of unknown function (DUF2961). This family of proteins has no known function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP93243.1|GH172	1.80e-233	5	451	6	452
UPK94269.1|GH172	1.58e-232	4	451	9	456
CAK39208.1|GH172	2.66e-232	4	451	5	452
QKD59092.1|GH172	2.91e-231	6	451	12	457
AEO68463.1|GH172	3.39e-229	3	451	10	456

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7V1V_A	3.02e-151	14	445	15	444	Chain A, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_B Chain B, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_C Chain C, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_D Chain D, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_E Chain E, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_F Chain F, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_A Chain A, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_B Chain B, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_C Chain C, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_D Chain D, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_E Chain E, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_F Chain F, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1X_A Chain A, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_B Chain B, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_C Chain C, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_D Chain D, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_E Chain E, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_F Chain F, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium]
4KQ7_A	6.17e-51	20	361	23	327	Crystal structure of a DUF2961 family protein (BACUNI_00161) from Bacteroides uniformis ATCC 8492 at 1.62 A resolution [Bacteroides uniformis ATCC 8492],4KQ7_B Crystal structure of a DUF2961 family protein (BACUNI_00161) from Bacteroides uniformis ATCC 8492 at 1.62 A resolution [Bacteroides uniformis ATCC 8492]

Swiss-Prot Hits     

I314_04964-t35_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000002

TMHMM  Annotations     

There is no transmembrane helices in I314_04964-t35_1-p1.