CAZyme Information: I314_04926-t35_1-p1

Basic Information

• Species: Cryptococcus gattii VGIII
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGIII
• CAZyme ID: I314_04926-t35_1-p1
• CAZy Family: GT15
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
863	KN848901|CGC2	95591.31	6.0219

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiCA1873	6782	1296111	148	6634

• Gene Location: location=KN848901:560230-563081(-)

Full Sequence      

MPTDNADLDRSFLTANIDDLLKQLTTEEKISLLAGKDWWNTVSIPRLNIPSIKMSDGPGG
ARGDSFYHMTPASALPSATSLASTFSPDLVHSAGSLLALETLARNAVCLLAPTINIQRSP
LGGRAFESYSEDPTLSGLIAAAYVAGLQEGGVSAAIKHFVGNDQEHERMGEDSIIAPRAL
REIYLRPFQIALKKSKPQAFMTAYNKLNGMHCSENGWLLEELLRKEWGFDGLVMSDWFGT
YSVSESINAGLNLEMPGATRWRPNGLVTHLIKAHKIDSRQLDKVAGGVLRWVQKLAKKNE
ELVYSLPGKERTRTEDQAKDAEFLRRLAGESIVLLKNEMNILPIRGQKKIAVIGPNAKAK
VLTGGGSAQLRSAWSSTPWQGLSDNAPEGVELSYSLGCYSSKFLPILDENFTCPDGSSGF
QLSHFPITSSGNKAEEPVHVETWDTSDMFLADFTAPGLTEKYFTQLDAVWTPVEDGEYEF
GVVVTGKGWLWVDGELVIDGSREEERSSSFFDSGTRELKGRTKVKKNKRYDIRLLHDTRP
YSVNNLITPIVSAGMRLGYRQIIPTSTLLSKAVSLAASSDVALLVVGLNSDWESEGYDRP
NLSLPMDTDKLINAVVEANPNTIVVIQAGSAVSMPWLDKVKGVLFAWYLGNETGNAIADI
IYGYINPSGRLPITFPKRELDIAANLNYKSARTKTYYGEGIWVGYKHFNARGIDPLFPFG
HGISYTTFVYSDLHVSQIPESPKNVGADGWKMEVEVQVKNNGREEGAHTVMFWLSPPPES
PSGLKHPEWTLQGFQKVYRLKPGEKRTVKVTFDKYAISHWDELWNTWRAEVGEWTVRVGV
DAQNINGEKATFRVEDDLEWRGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	43	256	2.4e-63	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	3.97e-70	15	852	36	762	beta-glucosidase BglX.
224389	BglX	2.23e-65	39	369	50	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.80e-50	332	725	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	2.81e-36	46	290	63	315	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	4.48e-35	20	798	56	729	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV23736.1|GH3	0.0	1	863	1	863
KGB76680.1|GH3	0.0	1	863	1	863
AAW44922.2|GH3	0.0	1	863	1	863
UOH84802.1|GH3	0.0	1	863	1	863
AGV14847.1|GH3	0.0	1	863	1	863

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.55e-212	16	863	5	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	9.81e-208	16	863	5	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	8.16e-129	13	845	1	660	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	5.97e-108	13	845	1	655	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	2.96e-103	14	854	51	828	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U8Y5|BGLI_ASPOR	1.58e-238	16	863	5	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	8.68e-238	16	863	5	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	8.68e-238	16	863	5	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	1.27e-237	16	863	5	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|A1CA51|BGLI_ASPCL	6.95e-237	16	863	5	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000020	0.000009

TMHMM  Annotations     

There is no transmembrane helices in I314_04926-t35_1-p1.