CAZyme Information: I314_04375-t35_1-p1

Basic Information

• Species: Cryptococcus gattii VGIII
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGIII
• CAZyme ID: I314_04375-t35_1-p1
• CAZy Family: GH71
• CAZyme Description: phosphatidylinositol glycan, class M

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
424	KN848899|CGC1	47719.43	9.9434

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiCA1873	6782	1296111	148	6634

• Gene Location: location=KN848899:579884-581280(+)

Full Sequence      

MLKAKTSQIILLSLSIHLALIIYADHVDSHPERYGGLRYTDVDWRVVTDGARLIFNPSEE
EQAKGWLVKKTGFPVGDPYNRATFRYTPLLPLFLSPALIHPLLGKCLLALPSLLIPLLLL
SGPDPAPFWPTHLLWTINPLVLSITTRGSPEAAICFLVIALHYFLRLGSEDKKKGAGETR
AAIMLALAVSWKIYPAIYIPAVWKELSTRWGWFGARVWRFGFIVASSFVLVNGILWSIWG
EPFLDHTYLYHLSRLDHRHNFSPYFYPIYLSFFPSPSASPLPSALLAVIRHPLTSFLPQI
TLILITSLSISSLDFTMFLQTALFVAFNKVCTSQYFTWFLPLLPPVIPQLHLSRRKTVTL
VIAWIVAQGVWLGSAYLLELKAQSVYIVVWAAGLLVFGVSIYVLGNLIDGWAPPVRARKS
KKLD

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	144	408	9.7e-80	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
252941	Mannosyl_trans	3.17e-57	144	408	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.
178434	PLN02841	1.12e-53	9	408	11	415	GPI mannosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV19492.1|GT50	6.72e-301	1	424	1	424
KGB75735.1|GT50	2.42e-296	1	421	1	421
AUB22890.1|GT50	1.50e-276	1	421	1	420
AFR93356.1|GT50	1.50e-276	1	421	1	420
AAW41613.1|GT50	7.12e-275	1	421	1	418

PDB Hits     

I314_04375-t35_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5F380|PIGM_CHICK	4.91e-65	18	422	20	417	GPI mannosyltransferase 1 OS=Gallus gallus OX=9031 GN=PIGM PE=2 SV=2
sp|Q7T310|PIGM_DANRE	3.41e-61	37	413	32	386	GPI mannosyltransferase 1 OS=Danio rerio OX=7955 GN=pigm PE=2 SV=1
sp|Q54IA4|PIGM_DICDI	9.07e-60	6	408	25	427	GPI mannosyltransferase 1 OS=Dictyostelium discoideum OX=44689 GN=pigm PE=3 SV=1
sp|Q4I073|GPI14_GIBZE	4.53e-58	5	412	9	409	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1
sp|Q66IJ4|PIGM_XENTR	1.04e-53	37	422	41	418	GPI mannosyltransferase 1 OS=Xenopus tropicalis OX=8364 GN=pigm PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000287	0.999696	CS pos: 24-25. Pr: 0.9784

TMHMM  Annotations     

Start	End
181	203
218	240
268	290
305	327
357	376
386	408