CAZyme Information: I314_03993-t35_1-p1

Basic Information

• Species: Cryptococcus gattii VGIII
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGIII
• CAZyme ID: I314_03993-t35_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
946	KN848898|CGC3	101788.94	9.9779

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiCA1873	6782	1296111	148	6634

• Gene Location: location=KN848898:357038-359986(-)

Full Sequence      

MVYTEPAPASTTPLASPTKEPLTWRKAHTSTKVDDLDSNMASTLPTIPRRSSSSSSSPRR
TVPNIPRHHLAGRHSFVISKPLEGLPRRSANSPRPSISGLPPAGEGSALGIKLHGSPIKS
PLSPRPKDLGSPSRNGNGVPSFKGQADSSSLAISFDPNFQPPKRDSPTRNPLSASTRPGA
SRRNSGSGHARGGQGATGSLQIPLPTSASTSELPSGPSSLSNVRPSAAMIRKKSGEIVKP
SLKPRSLSTPDLMRQGQNSPTGTSPNSFGTERSKSVRFADTSQGDAKALESVVLFLREQK
VTAVGKAADPDNAQLTETETENDTDASDFVQFRTRKNAAARAADEANQIQLSGASRVPRK
RTDFSPDARGSLIGENVILERVELQSGAGLTLRGSVIVRNVAFRKWVAVRFTLDQWQTVS
EIAGTHVCHIPASTTGDEGWDRFSFSIKLEDYKRKIDERQLVLCVHYSIENSDWWDSNNG
LNYAFTFKKSPPRRLFRSSGPASLGSNYFGDDDFASPLPGLRKGNTPPPSSQIKKVFGSK
DSKASSGSSHWAFPRLFPHFNHVDAPPRPDSPAQSPPPNSAYEPPAPPTVHTHLSLSKYC
APSPPQSPSKELPAQSLTAHETHHIPQQSSMDVMAGNYATISPALQLRPYERRSSWNGHA
SSWDSSRANDKPAGGRPDGDKTPMAMASHSPIISPDVPSPDVSPQKPLTLKRSTGNLRKL
VEDAEDENGLITPPSSKGSSPPTPVHASLPPDLVYTSPTSTGDTSSVNTLSTESTPDVAS
LSIDTEPQVGDRGRTGHPNDHRFFSANSYQEFLDKFCFFQSPRMTPNELEPISRPSHIPI
SGNNSPNGFPFFSHTNASRSPRSTPTPTRHYNSAQEAFGFTAPSQDVTPTKPESLMPHMA
HPHPQPVQDSSVSQIISGYHANPTDTMVWAQQIHSDSVSPSLAAAK

Enzyme Prediction     

No EC number prediction in I314_03993-t35_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM21	375	484	8e-27	0.9626168224299065

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397445	CBM_21	8.60e-37	372	486	2	113	Carbohydrate/starch-binding module (family 21). This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain.
407028	CBM53	1.70e-07	400	485	1	75	Starch/carbohydrate-binding module (family 53).
282904	Herpes_BLLF1	4.56e-04	4	337	474	794	Herpes virus major outer envelope glycoprotein (BLLF1). This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralising antibodies in vivo.
223021	PHA03247	0.008	516	614	378	476	large tegument protein UL36; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV22361.1|CBM21	0.0	1	946	1	947
KGB78028.3|CBM21	0.0	1	946	1	947
AAW43441.2|CBM21	0.0	1	946	1	948
AFR95423.1|CBM21	0.0	1	946	1	947
AUB25227.1|CBM21	0.0	1	946	1	947

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2M83_A	2.01e-11	375	489	30	137	Solution structure of the carbohydrate binding module of the muscle glycogen-targeting subunit of Protein Phosphatase-1 [Oryctolagus cuniculus]
2EEF_A	4.76e-10	367	483	26	133	Chain A, Protein phosphatase 1, regulatory (Inhibitor) subunit 3B [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6GQ68|PP3BB_XENLA	1.38e-10	367	483	117	224	Protein phosphatase 1 regulatory subunit 3B-B OS=Xenopus laevis OX=8355 GN=ppp1r3b-b PE=2 SV=1
sp|Q8C767|PPR3B_MOUSE	2.90e-10	358	517	114	261	Protein phosphatase 1 regulatory subunit 3B OS=Mus musculus OX=10090 GN=Ppp1r3b PE=1 SV=1
sp|Q00756|PPR3A_RABIT	1.20e-09	375	492	128	238	Protein phosphatase 1 regulatory subunit 3A OS=Oryctolagus cuniculus OX=9986 GN=PPP1R3A PE=1 SV=1
sp|Q16821|PPR3A_HUMAN	1.57e-09	375	489	126	233	Protein phosphatase 1 regulatory subunit 3A OS=Homo sapiens OX=9606 GN=PPP1R3A PE=1 SV=3
sp|Q6IN01|PPR3B_RAT	3.03e-09	358	486	114	232	Protein phosphatase 1 regulatory subunit 3B OS=Rattus norvegicus OX=10116 GN=Ppp1r3b PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I314_03993-t35_1-p1.