CAZyme Information: I314_03867-t35_1-p1

Basic Information

• Species: Cryptococcus gattii VGIII
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGIII
• CAZyme ID: I314_03867-t35_1-p1
• CAZy Family: GH5
• CAZyme Description: glucoamylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
575	KN848898|CGC1	64718.46	7.1583

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiCA1873	6782	1296111	148	6634

• Gene Location: location=KN848898:66819-68790(-)

Full Sequence      

MASRTDMESDLLSCEKGPLPRSVTLRPPGSIIEHNHHRYRSVVTKGLFLCLLILSAIVTK
ASLGLWSHCLNSQSIHFDHQSNQQSLLLESRILANIGPGIGAKEGLVVASPSRGHGKEPD
YYYTWTRDSALTISTLISHLRSDLADIDNATESWEMYGALSDTLKEYLFRDYIESQAEIQ
IGKNPSGDLKSGGLDEPKFHVNGTPFTGNWGRPQRDGPALRAITVMIYANFLLDRGFPSD
VSYVKQWIYEPRQLKAPGKVLKNDLEEVAHGWSKGGFDLWEEVDGHHLFTLLVSRKALYH
GSIFARRLKDFGAADHYLAQAHAITQKLPLFWDSKRGYWLSSLRGRDLELAPIKSEFEPT
NIYPRREWLDCALPLSIIHAGSHRLQPSHNFSFSFSAIDPNVLSTMHLYIKSFDGLYGIN
DGKSWLDGWALGRYKEDVYDGKGQCQGNPWFICTFSLAHSLYLAYKEFREVGAIVIANQT
LLFWEDVVSISSTPPKVGAGDVWIEGRDRRFTEGMKCLKEVAGRFMEVGLQVAKKNGGRM
SEQIGRDDGQFKGARDLTWSYASLLDLIRVRSDLD

Enzyme Prediction     

EC	3.2.1.3:94

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH15	96	567	9.6e-83	0.961218836565097

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395586	Glyco_hydro_15	4.87e-81	92	569	7	417	Glycosyl hydrolases family 15. In higher organisms this family is represented by phosphorylase kinase subunits.
225922	SGA1	3.54e-16	105	573	262	606	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV22493.1|GH15	0.0	1	575	1	575
KGB77909.2|GH15	0.0	1	546	1	546
AAW43660.1|GH15	0.0	1	575	1	577
CAY05375.1|GH15	0.0	1	575	1	577
AUB25359.1|GH15	0.0	1	575	1	577

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1AGM_A	3.67e-73	78	565	4	422	Refined structure for the complex of acarbose with glucoamylase from Aspergillus awamori var. x100 to 2.4 angstroms resolution [Aspergillus awamori],1DOG_A REFINED STRUCTURE FOR THE COMPLEX OF 1-DEOXYNOJIRIMYCIN WITH GLUCOAMYLASE FROM (ASPERGILLUS AWAMORI) VAR. X100 TO 2.4 ANGSTROMS RESOLUTION [Aspergillus awamori],1GLM_A REFINED CRYSTAL STRUCTURES OF GLUCOAMYLASE FROM ASPERGILLUS AWAMORI VAR. X100 [Aspergillus awamori],3GLY_A REFINED CRYSTAL STRUCTURES OF GLUCOAMYLASE FROM ASPERGILLUS AWAMORI VAR. X100 [Aspergillus awamori]
1GAH_A	3.77e-73	78	565	4	422	GLUCOAMYLASE-471 COMPLEXED WITH ACARBOSE [Aspergillus awamori]
1GAI_A	3.87e-73	78	565	4	422	GLUCOAMYLASE-471 COMPLEXED WITH D-GLUCO-DIHYDROACARBOSE [Aspergillus awamori]
3EQA_A	2.92e-71	78	565	4	423	Catalytic domain of glucoamylase from aspergillus niger complexed with tris and glycerol [Aspergillus niger]
6FRV_A	8.50e-70	78	565	4	423	Structure of the catalytic domain of Aspergillus niger Glucoamylase [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O60087|AMYG_SCHPO	6.04e-72	52	568	8	440	Probable glucoamylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=meu17 PE=2 SV=1
sp|D8Q9M3|AMYG_SCHCM	8.98e-72	54	571	3	451	Glucoamylase ARB_02327-1 OS=Schizophyllum commune (strain H4-8 / FGSC 9210) OX=578458 GN=SCHCODRAFT_57589 PE=1 SV=1
sp|P42042|AMYG_BLAAD	6.88e-71	101	574	187	611	Glucoamylase OS=Blastobotrys adeninivorans OX=409370 GN=GAA PE=3 SV=1
sp|P22832|AMYG_ASPUS	4.91e-70	39	565	3	446	Glucoamylase OS=Aspergillus usamii OX=186680 GN=glaA PE=3 SV=1
sp|P23176|AMYG_ASPKA	2.57e-69	39	565	3	446	Glucoamylase I OS=Aspergillus kawachii OX=1069201 GN=gaI PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999952	0.000043

TMHMM  Annotations     

Start	End
46	68