CAZyme Information: I314_02998-t35_1-p1

Basic Information

• Species: Cryptococcus gattii VGIII
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGIII
• CAZyme ID: I314_02998-t35_1-p1
• CAZy Family: GH3
• CAZyme Description: chitinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
501	KN848895|CGC4	53431.82	4.6796

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiCA1873	6782	1296111	148	6634

• Gene Location: location=KN848895:100352-102106(+)

Full Sequence      

MYFPLLPNLGPITLAIATHSGMTHTRQLLALAIPFVSLVPVEILVNFHQVAVAVTSASAA
GGVTSATVAGGINVTGTGTTGGDAAASSSSGAAVITARSAVASSVSHTNSAASPSGTSTS
NGASGSNRFVTYWDNYANIGGVNAAQLTAVTHVILSTLLTHLIVIAFADMTNWATKQTTW
QFMKSSDGNFDSSTAATLRGIQPGLKVCGAFGGWVLDSVMATAVRGGDSSIATFVANVKG
FADYFNLDGIDIDWEFPSASDDANLITFVTQLRAALGDDKLISIALGARVDTTDAAAFNS
DTFSKLDGLVDMWNVMTYDYVNRYSTTTEQQAGNRVITTVMDYYEKQGITMEKCNIGFPM
NAKYFTLTETCDSSNPNGCSLPGKEYYEDNGVDNYKSGWIRFNPGLDSTLGTKGTEWATK
MRAQWEARPADGSTEITADVSHAWVDEINNVFWTWLSDSDMKKTCQNWVTSDKVGGAMVW
SLNQVTISIHSIVYAQMLIHF

Enzyme Prediction     

No EC number prediction in I314_02998-t35_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	127	485	1.4e-46	0.9358108108108109

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395573	Glyco_hydro_18	1.36e-38	128	484	1	306	Glycosyl hydrolases family 18.
214753	Glyco_18	1.18e-31	130	484	3	333	Glyco_18 domain.
119349	GH18_chitinase-like	4.24e-28	129	319	1	177	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
119351	GH18_chitolectin_chitotriosidase	1.41e-26	157	382	26	260	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
119365	GH18_chitinase	8.19e-26	150	360	17	261	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV25006.1|GH18	3.83e-314	1	501	1	501
KGB77350.3|GH18	7.27e-256	51	484	75	498
UOH83768.1|GH18	6.84e-233	126	484	161	509
AAW46130.2|GH18	7.08e-233	119	484	155	510
AFR94094.2|GH18	9.70e-233	126	484	161	509

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6TSB_AAA	1.02e-13	198	390	84	291	Chain AAA, Peroxiredoxin [Clostridioides difficile 630]
6T9M_AAA	1.16e-13	198	390	103	310	Chain AAA, Peroxiredoxin [Clostridioides difficile 630]
6LE7_A	4.75e-12	205	483	77	345	Chain A, Probable endochitinase [Caenorhabditis elegans]
6LDU_A	4.80e-12	205	483	78	346	Chain A, Probable endochitinase [Caenorhabditis elegans]
1WNO_A	6.77e-12	205	480	90	346	Crystal structure of a native chitinase from Aspergillus fumigatus YJ-407 [Aspergillus fumigatus],1WNO_B Crystal structure of a native chitinase from Aspergillus fumigatus YJ-407 [Aspergillus fumigatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9W092|CHIT2_DROME	8.60e-12	158	483	69	387	Probable chitinase 2 OS=Drosophila melanogaster OX=7227 GN=Cht2 PE=1 SV=1
sp|Q95M17|CHIA_BOVIN	1.95e-11	158	483	50	363	Acidic mammalian chitinase OS=Bos taurus OX=9913 GN=CHIA PE=1 SV=1
sp|Q873X9|CHIB1_ASPFM	4.05e-11	205	480	128	384	Endochitinase B1 OS=Neosartorya fumigata OX=746128 GN=chiB1 PE=1 SV=1
sp|E9QRF2|CHIB1_ASPFU	4.05e-11	205	480	128	384	Endochitinase B1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chiB1 PE=3 SV=1
sp|Q11174|CHIT_CAEEL	4.42e-11	205	483	129	397	Probable endochitinase OS=Caenorhabditis elegans OX=6239 GN=cht-1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.971589	0.028420

TMHMM  Annotations     

There is no transmembrane helices in I314_02998-t35_1-p1.