CAZyme Information: I314_02417-t35_1-p1

Basic Information

• Species: Cryptococcus gattii VGIII
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGIII
• CAZyme ID: I314_02417-t35_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
471		52582.68	5.2118

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiCA1873	6782	1296111	148	6634

• Gene Location: location=KN848893:402623-404309(-)

Full Sequence      

MFSLGAFITTTICLLSHLPTALAFGVQNYPNLFFDASAVVSNQWFNGVDSRWAREMSEHW
AQTLIHYGPWSVTNKSYTAKSGDKKDYLSWAVYHWPNCSNVQNTTELTQEEVWDQCDYVV
RDGQVNPDIELVKDKEALQNMSNSVYLSAMAYLHTNDSQYTTHINHALHTFFINNDTRMN
PNLNYAQVIRGPGDQMGRHTGVLDLACMAKIASGVQVMRSVKPAEWQQETETGIMQWASE
QLNWLYTSEQGLGELNATNNHGTFAVNQVCALNVLLNQNDACVTALEDFYNGIYMDQIAA
NGDQPLESARTRPYHYRAFNLMALVTNAQFGDFVGLSPSAWERRSAANTTLVDALHYAML
QNYSASNELTQGRALNPVVAAVSAKYGDPDNKYANFLKSADPYFPGQPWFALNEGLSDAG
IKQGLLETTYGPVPPQPTLRAGSPDDPGYQRKRDWKPIGTGWPTTAPKAPW

Enzyme Prediction     

No EC number prediction in I314_02417-t35_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL38	72	359	3e-88	0.96415770609319

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398861	Alginate_lyase	3.69e-72	71	359	1	265	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV20174.1|PL38	0.0	1	470	1	470
KGB74556.1|PL38	0.0	1	470	1	470
AAW40805.1|PL38	8.71e-312	1	470	3	472
AFR92301.1|PL38	3.10e-305	1	470	3	472
AUB21714.1|PL38	3.10e-305	1	470	3	472

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NFV_A	6.28e-26	61	321	37	282	Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.95 A resolution [Bacteroides ovatus ATCC 8483],3NNB_A Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.60 A resolution [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

I314_02417-t35_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.004035	0.995955	CS pos: 23-24. Pr: 0.9604

TMHMM  Annotations     

There is no transmembrane helices in I314_02417-t35_1-p1.