CAZyme Information: I314_01794-t35_1-p1

Basic Information

• Species: Cryptococcus gattii VGIII
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGIII
• CAZyme ID: I314_01794-t35_1-p1
• CAZy Family: PL38
• CAZyme Description: UDP-glucose,sterol transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
792	KN848891|CGC11	87540.44	5.9039

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiCA1873	6782	1296111	148	6634

• Gene Location: location=KN848891:1162806-1166223(+)

Full Sequence      

MELPPPYEAQTGPSTSASGDTYVAVPADVDGNAFMSCGSGLQVRSSLTTYGDVNIWIDVQ
GKLDDLPAAVAPKVKEYALDPQGTVPSLNIVMFAIGDEDDLRPFISLAIELIITYSHRIR
IATQEIYEGSLIAEAKKYLSRRTGRDDRVGLHDKLEIYPLFAPPDGNPSTWTEDQSTLEP
TLRSLYRSTFDASVTRTDLPFAADLIISAPNVPCHVYIAELLGLPIHILSTTPYSPTVIR
PHPRVIVQRSNTNASLTNYLSYPIYENQVWHSLGRVINEFRVASLGLPALSQMNGPGVLD
RLKIPFTYCWSPSVLKKPEDWRDDIGVTGFIFDHNEQIDFHPPDELLCFLKSGKEPVYVK
DGTCSIPMASVREENFSNLSRRYFWGRQMHQIGIAARAISLDVLSYEDISYALEEALSPT
VQTAAREYGSQLSLENGTKETAETIHKHLPLLNMRCDIIPSRAAIWYSPEYNLHLSGIAA
GVLVDEGKLSFNSLEPNLEYPVNIADSDPIIGGAQAFFLALTASVSNVLHMFDQPVPQRE
VDISAQQPVIIAQVQNPLGGWTWSYEQATRQRIPITDFRSGLKEARDEITTGMKDGMKAL
VMEPMHGLKEGGPIGGVFGLVRGGVSLVTRPLGSGISAVRYGAEGAIREVDGRTTTPFIL
DRASPAESLRPSRKAASIEELKEVVLEDRKRILEEFKHAKSDEATKSRKVRHEAIMLGRM
PERAIGGIELGRYTSPLSNEVSRSNKKWWKGKGKGKERASDMTLRSEQSLQSSPGLTSVS
SSVKEFWPSEKK

Enzyme Prediction     

No EC number prediction in I314_01794-t35_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.61e-16	88	359	1	244	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV23276.1|GT1	0.0	1	792	1	792
KGB76612.2|GT1	0.0	1	792	1	866
AAW44796.2|GT1	0.0	1	792	1	868
UOH82765.1|GT1	0.0	1	792	1	860
AFR96358.2|GT1	0.0	1	792	1	870

PDB Hits     

I314_01794-t35_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	7.26e-30	84	450	152	575	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	3.20e-26	85	450	190	611	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q0CKU4|ATG26_ASPTN	5.27e-21	61	372	865	1165	Sterol 3-beta-glucosyltransferase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atg26 PE=3 SV=1
sp|A2QNQ5|ATG26_ASPNC	5.52e-19	87	372	896	1164	Sterol 3-beta-glucosyltransferase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=atg26 PE=3 SV=2
sp|I1S8Q3|ATG26_GIBZE	5.64e-19	72	363	935	1205	Sterol 3-beta-glucosyltransferase ATG26 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=ATG26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000026	0.000017

TMHMM  Annotations     

There is no transmembrane helices in I314_01794-t35_1-p1.